SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021120 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021120
Domain Number 1 Region: 113-255
Classification Level Classification E-value
Superfamily Cadherin-like 2e-29
Family Cadherin 0.00015
Further Details:      
 
Domain Number 2 Region: 337-463
Classification Level Classification E-value
Superfamily Cadherin-like 7.33e-24
Family Cadherin 0.00028
Further Details:      
 
Domain Number 3 Region: 230-341
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-21
Family Cadherin 0.00032
Further Details:      
 
Domain Number 4 Region: 46-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000116
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 450-549
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000807
Family Cadherin 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021120   Gene: ENSTNIG00000017958   Transcript: ENSTNIT00000021353
Sequence length 739
Comment pep:known_by_projection chromosome:TETRAODON8:13:4377642:4380896:-1 gene:ENSTNIG00000017958 transcript:ENSTNIT00000021353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPGFQNELSAGPWSRVKREWVIPAVNLPENLKGPYPKIVLKIKSNNQNKVAVTYKISGPG
ADQAPEGLFIIDQHSGVLYVTQPLDREKAATYSLRAHAMNERRNVEDPIELLINVIDQND
NAPTFTHSRFYGGVSESAEIGDSVIKVTAVDQDDPHTTNAIIRYRITAQRPQTSGGMFDI
DPVSGRIGVKAPGLDRETQPEYKLVVEAADLEGEGLTSTCTAVITVIDSNDNAPLFSNTF
SFASVLENVVGAEVIRLQVSDKDDSGSPNANTKYSLIKGNEGGEFSISRAANKMDAILRT
AKALDFEGRSGFTLMVVATNEVPFTGPVTTSTATITVEVLDQNEPPVFSPVELRVSITEN
ANVGSSVADLRAEDPDTTQKQSVRYKLHNDSVGWLSIDKDSGSVKVKSSMDRESRYVTDG
NYNILVLAYDDDIVPATGTGTLLVSLLDENDNGPVIKQRTASLCSRRPAPVQLDVMDPDG
PGHAGPFTLELLGEHEINWTISANSTTHLATLAPTRELSPGRYKVLLRLYDAGWLFQDST
LDVEVCPCQGAVSTCSISYSAAPRLSAPSVLTSTLGAVFCLLLLILLLLLLLRRRRRRSE
KEATLFEELPRENIFIYNEEGGGEEDREFDWTLLSRGPGSCAEVTCTQGLPPDRSHPGCQ
HLRAHEDISRFLKDKLQAAGGGVPAPPHRSPLVLDRQGAGSQASSLFTDPDEEQNFQRLD
GWGPGSCNRVELCADRTDE
Download sequence
Identical sequences H3DKS3
ENSTNIP00000021120 99883.ENSTNIP00000021120 ENSTNIP00000021120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]