SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021196 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021196
Domain Number 1 Region: 396-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-21
Family MAM domain 0.0023
Further Details:      
 
Domain Number 2 Region: 21-174
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000565
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 131-249
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000895
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021196   Gene: ENSTNIG00000018030   Transcript: ENSTNIT00000021430
Sequence length 538
Comment pep:known_by_projection chromosome:TETRAODON8:18:6814727:6839708:1 gene:ENSTNIG00000018030 transcript:ENSTNIT00000021430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWPRQMAASNGLCRYGARVDCCWGWTRRSWGHCQPVFALTHRVTRIRCQPQALCQPGCKH
GECVGPNKCKCHPGFTGKTCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLLPDGT
CGNARTCGLANCQYGCEVLKGEVRCQCPSPGLQLAADGRTCVDVDECATGIAVCPRFRKC
VNTFGSYVCKCHEGFDLQYINGKYQCLDVDECSLGRSHCSSYATCYNTPGSYKCKCRDGF
GGMGHDCKPIPRVIIDPPRPGKIPPNHHNHIPDSKSTTAIMTTTAKTTTAKMTTMSPATT
RVPPLTKKVTPPTRRPEVVTWKPFVPTPTRKPYIPPPPPPPVTPVDNSIQKEVTKQRGDV
HIPRNHDRNTVLDIDFDIELGNTADESKDDPESGFLSCSFDDGLCSWIRNNNGDVHWETT
PDPSGGRYLTIPEVGNKRTGRGAQLVLPLTPPWNDGNLCLSFRHKLAGHHVGMLQVFVKK
GKQYSPAVWGRTGGNGWRHTQITLWGTGLESVILKGERSRGRMGEMAVDDIALRKGAC
Download sequence
Identical sequences H3DKZ8
ENSTNIP00000021196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]