SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021203 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021203
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.08e-36
Family Ankyrin repeat 0.0000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021203   Gene: ENSTNIG00000018037   Transcript: ENSTNIT00000021437
Sequence length 125
Comment pep:known_by_projection chromosome:TETRAODON8:18:6670060:6671807:-1 gene:ENSTNIG00000018037 transcript:ENSTNIT00000021437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMPLEDELTAAAAKGDTAQVRLLLGAGAQVNGVNRFGRTALQVMMMGSTSVAQVLLDHAA
DPNVADRSTGARPLHDAARSGFLDTVRLLVLFGANPDTRDQWDRRPVDLARDEGHTDVVA
FMESL
Download sequence
Identical sequences H3DL05
ENSTNIP00000021203 99883.ENSTNIP00000021203 ENSTNIP00000021203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]