SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021208 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021208
Domain Number 1 Region: 53-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000034
Family HLH, helix-loop-helix DNA-binding domain 0.000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021208   Gene: ENSTNIG00000018042   Transcript: ENSTNIT00000021442
Sequence length 206
Comment pep:known_by_projection chromosome:TETRAODON8:18:6633995:6649433:1 gene:ENSTNIG00000018042 transcript:ENSTNIT00000021442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNSLLILLEAAEYLERRDREAEHGYASVLPYTNDFSRKKTKASPMSRKTQNNRSSHNE
LEKHRRAKLRLYLEQLKKLVPLGPDSTRHTTLSLLKRAKMHIKKLEEQDRKALNTKEQLQ
REHRYLKRRLEQLSVSGSVERIRTDSMGSTISTDSEQEVDIEGVEFTPVEADSVDSISDD
QYGLQSSSSDTSYTATHSHRLQPHHC
Download sequence
Identical sequences H3DL10
ENSTNIP00000021208 99883.ENSTNIP00000021208 ENSTNIP00000021208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]