SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021226 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021226
Domain Number 1 Region: 943-1227
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.21e-88
Family Complement components 0.000000518
Further Details:      
 
Domain Number 2 Region: 1451-1605
Classification Level Classification E-value
Superfamily TIMP-like 2.3e-40
Family Netrin-like domain (NTR/C345C module) 0.0015
Further Details:      
 
Domain Number 3 Region: 1303-1451
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.89e-35
Family Alpha-macroglobulin receptor domain 0.0011
Further Details:      
 
Domain Number 4 Region: 620-692
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 2.62e-22
Family Anaphylotoxins (complement system) 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021226
Domain Number - Region: 773-820
Classification Level Classification E-value
Superfamily E set domains 0.0154
Family SVA-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021226   Gene: ENSTNIG00000018059   Transcript: ENSTNIT00000021460
Sequence length 1608
Comment pep:known_by_projection chromosome:TETRAODON8:18:6424515:6435266:-1 gene:ENSTNIG00000018059 transcript:ENSTNIT00000021460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLSAPNVLRVGTTENIFVECQDCTQDMTVSIKVLNFPTKATTLASTSVNLNQGNKYQAL
GKVKIPQSNFNKDPKMKQNVYLHAQFPGRLLEKVVLVSFQSGYIFIQTDKTLYTPNSKVN
YRVFVVTPNIEPMVREDSTQTDTTISIEFQTPDGIILPHETVSPTSGIHSGSFKLTEMVS
TGIWKVVVKFQSSPQESFTADFEVKEYVLPSFEVKLASVTSFFYVDTQKLTVQIKATYLF
GKEVEGVAFVVFGIIDGDTKKSIPQSFQMVQIQGGKGVATLKREDVPHTFPEIEKLVGSF
IFVSAIVQTENGGEMVEAELKNIQIVTSPYTINFWKTPKYFKQGITFDVTAEVLNPDKTP
ALFVDFHLDVTVVNKYSGLPSKARTDAPNILSERQASATMTVHPQIHKSNNFIHIVIYTA
EVTMGETIKVNFFFGQSIWKDITYLILSRGQLVNFGRYQAKGQKLISHMLIISKEMLPSF
RIVAYYHPSDDEVVSDSVWVDVDESCMGSLKLEPSRLTVSYEPRRMFGLRVTGDPGATVG
LVAVDKGVYVLNNHRLTQKKIWDIVEKYDTGCTAGGGKDSINVFYDAGLLFESNLVPGTN
YRKERKCETQSKRRKRASTIMDVTTSLTSQYKDELERLCCLDGMHVIPLSYSCERRSEYI
QDGEACVKAFLHCCKEIEAHREEGKEQSLILARSEEDDSSYTDEITTRTQFPESWLWTDV
NLPVNCPVDEPSCKTTSLEKTFPLQDSITTWLFTGISLSENHGICVSAPLEVIVRKDFFV
DLQLPYSAVRGEQLEIKAILHNYSPDLITVRVDLIEVEHVCSSASKRRRYRQELNVAPDS
TRSVPFIIIPMKEGELPIVVKAAVKDSSLNDGISKILRVVPAGVLVKASHIITLEPNKRG
GTERKILNSGISLTEIVPNTPKSTQISVTGREELSTMLETAISGNMMGSLISQPFGCGEQ
NMITMTLPVIATMYLDKTNQWEDVGFQRRADGLRHIKTGYQNELAFRKSDGSFAVHPNVQ
SSTWLTAYVVKVFAMASNLVPIESSVICDAIRFLISQTQNSDGSFREIGRVYSSGMNGDV
QGKDADASMTAFCLIALQEARSTCHSTVSNLPDSISRAVNFLETRLPHLTYSYAVAMTSY
ALANEKKLNRTKLFQYKSSDSTHWEVPKGIYTLEATAYALLALVKAELFTEAAPVVRWFT
TQQKDGGGYGSTQATIIVYQAVAEYWANSKEPEYDISVDILLPGRSGPEKYQVNRENHYL
TRTTKVNTINQDIVVTAKGSGEVTVKMVSLYYALPKEKAAARSLSMSVQLIEEKTDEVER
VYKLRIDVLFKNKNSDATMSILDIGLLTGFTVNTRDLDLLSKGRARIISKYEMNTFLSER
GSLIIYLNKVSHRQPEEISFRIHQRLKVGVMQPAAVSVYEYYDQTPCVKFYHPKRKAGEL
LQLCRNEECTCAEENCSMQKKEKISDDDRIAMTCVTSSNAKTDFVYKVQVDDFYEDLSTD
VYTMSILESIKEGSYDVGPQGKQRVFLGFPNCRKSIGLVKGKTYLIMGLSTDIYKDEKNQ
MYQYVLGERTWIEYWPTVAECQTDEYRPTCLGMEDMVAQYRLFGCLNK
Download sequence
Identical sequences H3DL28
ENSTNIP00000021226 99883.ENSTNIP00000021226 ENSTNIP00000021226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]