SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021260 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021260
Domain Number 1 Region: 569-661
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000157
Family YWTD domain 0.0000381
Further Details:      
 
Domain Number 2 Region: 198-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000916
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 3 Region: 23-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 4 Region: 233-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000102
Family LDL receptor-like module 0.00033
Further Details:      
 
Domain Number 5 Region: 113-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 148-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 7 Region: 69-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 8 Region: 357-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000135
Family EGF-type module 0.00099
Further Details:      
 
Domain Number 9 Region: 278-314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 10 Region: 321-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000326
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 11 Region: 672-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000346
Family EGF-type module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021260   Gene: ENSTNIG00000018095   Transcript: ENSTNIT00000021495
Sequence length 875
Comment pep:known_by_projection chromosome:TETRAODON8:1:20709704:20754717:-1 gene:ENSTNIG00000018095 transcript:ENSTNIT00000021495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRTANLPEIYFIMVRLKILSFTAKNTCATTDFTCKNGQCVPARWRCDGEPECADGSDEAD
ATCRFHKSVTCPPEKFDCGGSASKCVSLSWRCDGERDCENGADEEQCAADGKACPANDFQ
CRNGKCVAPIFVCDGDDDCGDGSDEEKCSAPTCGQHEFRCNDSECIPTLWSCDGDPDCKD
KSDESMERCSRRTEPKKPRCPVGEFQCGSGECVHMNWKCDGDADCKDKSDETNCPLLTCR
PDEFQCGDGSCIHGTKQCNKVHDCPDYSDEAGCVNVTKCDGPKKFRCKNGECIDSSKVCD
SVKDCKDLSDEPIKECGVNECEDNNGGCSHICRDRRIGYDCDCPSGYKLLDKKTCGDIDE
CENPDACSQICINYKGDYKCECYEGYEMDPVTKTCKAVGQTPMQHLPSGSWSSHTVKKRT
ALYARHTHXKEVLVEIAAISLRLGHYRLNWSVNATSVRLFLACSKQITQVSSISLKSHTF
EKPCSCPLKCCLFLFTPTGNCSIISQQCYTSWANLKSMPIAKHSDLIFWFKYASFVPCVG
YKIKGGGIGGIAFLKHSQIYSDFSAFPSDLSNRRLYWVDSKLHLLSSVDLNGDNRKVLLS
SHRHLGHPFAVTVFEDRLYWTDVEEEAIYSANRLTGHDVAKVAEHLNNPLDLVVFHEQRQ
PKAPDACNMGSLPNGGCEYLCLKAPQITEHSPRYTCACPDGMELGPDMRRCVVALVTTTS
STTTTSVATTVRRLTTHAPRSTSTEHPETTFATSTETTGFSSARQPPTSTHTPLVAPNSI
QRESNGNLSHRGNNITVAVLGIVIPIVVIGLLCTGGYLVWRNWRRKNTKSMNFDNPVYRK
TTEDDDDEIHIGRHSESIGHVYPARVALSLEDDGY
Download sequence
Identical sequences H3DL62
ENSTNIP00000021260 ENSTNIP00000021260 99883.ENSTNIP00000021260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]