SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021261 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021261
Domain Number 1 Region: 813-982
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-37
Family Ankyrin repeat 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021261   Gene: ENSTNIG00000018096   Transcript: ENSTNIT00000021496
Sequence length 991
Comment pep:known_by_projection chromosome:TETRAODON8:1:20689633:20698524:1 gene:ENSTNIG00000018096 transcript:ENSTNIT00000021496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKKNANGVQTKAGEGGAPKKQLPYSVETPYGFYLDLDFLKYVDDIEKGNTIKRVHIQRR
IKGPPKFSTLPRNFSLPGHGVRPVPKEKDSTWSGTSTLGPKPKSRVAEVQQIFDFRASER
TTSTQSNRAAVSPGGGFSLAKPRDEAQEGEVKTILGQTRPNLLRASSMPITLQQRKGSDS
SSPDRTVGTPESGSTENMFRASPDITERRCIPQDRTGLHQQITVALKRVRELEEQVKTIP
ELKAQIFSLKEEREQLLLQLQAHVSTSPSAVDPGSYTESQEHKPPERLSPSVSTQPTGVS
ECLPTKELPSLVEVRQDASRIHHAVKEGKREDSKQKLQEKLSTLEAKLARATQELDRTSV
LLKEQLQENKLKEEKILQAEMVTAKNDSGTKEILPTKSEISQIVDTQPLTIETEDKGPKE
DGETLRETIKEAVIGEKTVVPVRPQRGKKPPAADQAEPSTPQQPAPVRPRRGSSEAQSQQ
AQPSTKGQPQVQTQGPPQLEGTQVPHPGPSLSHNEDVAEKLQGEPGSGESPTSPAALGQV
VTRLTGLLGEQWAQLGSSSGAQQPASQQESPASKMSSIQSQLVSSLSVLSAFYSPGQKAT
SASKHPPFSLSSLSLHLPPSSDSPGLKSIMKKDGVADKQGNKRAKKNLKFVGVNGGYEST
SSEESSGEDKPKAAVEDEDSSGAEEEKKRKAEPQPAEKPEKEAEAQQKEEDVPAAEEGAS
AAEQRSDRGLLDPEGSSELLEEQAEGFIDACVYVKDRMEEVSSPDKEMVRRQVLVALYQE
WFRVSSQKDSQADTVRSYLRQVSLTTPTLLPYVVNLTDGNGNMALHYCVSHSNFPVVKLL
LDTGLCETDNMNKAGYTPVMLAALTAADSPDDLEVAQQLLKLGNVDACSRQAGQTALMLA
VSHGRVAMVKLLLSCGADVNLQDYEGSTALMCASEHGHAHIVGLLLETGRCDLSLADKNG
QTAQKVAEGASHQDIIDLLKAHAEASSTADL
Download sequence
Identical sequences H3DL63
ENSTNIP00000021261 ENSTNIP00000021261 99883.ENSTNIP00000021261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]