SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021290 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021290
Domain Number 1 Region: 62-477
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.89e-155
Family Myeloperoxidase-like 0.00000000000427
Further Details:      
 
Domain Number 2 Region: 22-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000244
Family EGF-type module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021290   Gene: ENSTNIG00000018124   Transcript: ENSTNIT00000021525
Sequence length 568
Comment pep:known_by_projection chromosome:TETRAODON8:1:20003006:20006586:1 gene:ENSTNIG00000018124 transcript:ENSTNIT00000021525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFTFAVSLLALSFLLCEAGNPCCSEPCQNRGVCTPIGKDSYECDCTLTGYAGPNCTTP
EFLTWVKVSLKPSPNTVHYLLTHFKGFWNIVNNISFLRDAIMRYVLTSRSHLIESPPTFN
ADYDYKSWEAYSNLSYYTRTLPPVSKDCPTPMGVAGKKELPDSKVLAEKVLMRRQFIPDP
QRTSLMFAFFAQHFTHQFFKTDSKKGPAFTAAQGHGVDLGHIYGGDLERQHKLRLFKDGK
LQHQVINGEVYPPTVKDVGVEMQYPPHIPESERFAVGHEAFGLVPGLMMYATIWLREHNR
VCDVLKEVHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFKERF
QYQNRIASEFNTLYHWHPLMPDSFHIEEKEYSYKEFVFNNSVVTRHGISHLVESFTKQLA
GRVAGGRNVPKSLLYVSIKSIENSRQMRYQSLNAYRKRFSMKPYSSFEEMTGGTETKPLF
KSLRKTPLCNRLLINKNRLWGSVIPGSFGPPPCRNSSANNVRGPCPVVSFHVPDVKETGP
VIINSSTSHEGESNVNPTVIFKERTTEL
Download sequence
Identical sequences H3DL92
99883.ENSTNIP00000021290 ENSTNIP00000021290 ENSTNIP00000021290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]