SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021298 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021298
Domain Number 1 Region: 10-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.01e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00044
Further Details:      
 
Domain Number 2 Region: 124-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.2e-40
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 935-1147
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-33
Family Laminin G-like module 0.0065
Further Details:      
 
Domain Number 4 Region: 310-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-33
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 5 Region: 539-561,764-925
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 6 Region: 547-604
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000673
Family Fibrinogen C-terminal domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021298   Gene: ENSTNIG00000018132   Transcript: ENSTNIT00000021533
Sequence length 1290
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:22515210:22525234:1 gene:ENSTNIG00000018132 transcript:ENSTNIT00000021533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCENSLATPLPYSSFTSSSVYAGGYGAGFAKLKRKQGAGGWSPVDTDHYQWLQVDLGSRK
EIVAVATQGRYSSSDWTRKYQLIYSDTPKNWRPYLQDGNIWTFEGNINSEGVVRHELQHA
ILARYIRLIPVDWSREGRIGVRLELYGCSYWADVISFDGHGVISYRFRSKKMKILKDVIS
LKFRTTSEDGVLLHGEGQQGDYISLELRRARLQLSINLGSNQYGSIQGHTTVTSGSLLDD
DHWHSVVIERYRRNVNFTLDHHTQRFRTNGEFDHLDLDYEISFGGMPLSLKPSSGGRDNF
VGCMEGITYNNDNITNMVRRKKVDTSSFRNLTFSCAESNSFSVFFNSTSFLKLPGQSDSD
TLSVSLSFRTWNPSGLLMFTTLADGWVEVGLSEGKVIVYVTLTQTKTTRIDISSGSGLND
GQWHSVHLNVLENHAMLTVDGDEASTVRTAIPVQIQTGGTYYFGGYFLHTNTRSPQRSFQ
GCMQMIHIDDHLADLRAVEQGLIGTFENVSLDMCAIIDRCFPNPCEHGGYCSQTWDMFTC
NCSGTGYAGATCHTSMYQQSCEEYKHQGRSSGSYWIDPDGSGPVAAFEVTCDMTGETVWT
KLKNNVSPQTPVMSTEENGKAVLQVTYNVSDEQMLSVTSSAEYCEQYVAYACRMSRLLNS
PDGVPFTWWVGRANERHSYWGGSGPGIQKCSCGIEHNCTDPKRYCNCDADLRAWREDAGL
LVYKDHLPVNQVVVGDANRGGSEAKLTVGSLRCRGDWNFWNAASFSSPASYLHFASFRGE
TSTDISFYFKTSSTHGVFLENLGLNDLLHIELKGGSVVLFSFDAGDERVELSVRSPQPLN
DDKWHRVEVEKNIQEAALQLDGQYREVRPASPQGRTKLEFYSDLYVGASSGQRGFLGCMR
ALKINGVTFNLKAKAETSPGVSPGCQGHCSSYGTHCRNGGTCVEKYNGYSCDCSLTAYDG
AFCTEDVGGYFETGTLVRYDFPPEAANFALPETKSQAGVGLLHGANLTQEELVFSFSTSS
TPSILVYVSSRTQDYMAVVLKHNGTLQIRYSLGGLAEPYTIDLHQRNMANGQPHSVNVSR
NQREIRLQLDHYPVSTYTLPEESDTQFNLVKSIFLGKVFETGQIDPVLIERYNTPGFVGC
LSRVQFNSVAPLKAALRSGQGAPGSAKGILVPSNCGASPLTISPMASAADPLALRSFCAA
GALFPFNEDKATDEEVDRNSAVVGGIISMVIFTVLCIMVFVVRHLFRHKGSYHTNEAKGA
DAADCADAAIIVSDPAFTETIEESKKEWFI
Download sequence
Identical sequences H3DLA0
ENSTNIP00000021298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]