SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021302 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021302
Domain Number 1 Region: 713-782
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000143
Family IBR domain 0.0002
Further Details:      
 
Domain Number 2 Region: 4-87
Classification Level Classification E-value
Superfamily PUG domain-like 0.0000000000157
Family PUG domain 0.0065
Further Details:      
 
Domain Number 3 Region: 630-696
Classification Level Classification E-value
Superfamily RING/U-box 0.000000168
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 4 Region: 347-372
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000011
Family Ran binding protein zinc finger-like 0.0028
Further Details:      
 
Domain Number 5 Region: 797-861
Classification Level Classification E-value
Superfamily RING/U-box 0.0000742
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021302
Domain Number - Region: 288-313
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000392
Family Ran binding protein zinc finger-like 0.0039
Further Details:      
 
Domain Number - Region: 512-546
Classification Level Classification E-value
Superfamily UBA-like 0.00468
Family UBA domain 0.023
Further Details:      
 
Domain Number - Region: 153-185
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0167
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021302   Gene: ENSTNIG00000018136   Transcript: ENSTNIT00000021537
Sequence length 1000
Comment pep:novel chromosome:TETRAODON8:Un_random:22552446:22568368:-1 gene:ENSTNIG00000018136 transcript:ENSTNIT00000021537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRLSTALNILEKYGCNLTNPNRPKYWRTVKHNNPVFRATVDAIQGGRNVLCLYGYSNQQ
PDGLSFPDDVIDPDVGRVAAVTLEVMSLRTELEMLIKEAHPHPEFYERIIPTLRHKAQQP
DQVSGSAPPSPVHQGEQPRPLSAVRSPEPAVNTNNCSICEIFRISAHCLTCLQGFCSECD
RLYHSYPDRANHRRTTVTSKPSLASQRRSSNNLKSEPEKADLGAVNARSDVSVRPCPSTW
CCLHCLKVNSLQEVLCEECELPRTSSFNSKADESQPKPGLSETVCLSSEWHCKSCTMVNA
ASSVLCEVCERPRLATRPPATPSHKPANPPRPPAPGTDEHLSSIFSSQWVCQFCTYLNYS
PATMCEMCDLARPEPAPLPVKLSPPSPVRRVPALPLKPKELASDARHSCRQMQMKEDGLK
LIQLIREGEKKGMSPEEVCMSVRVTGDRSSLPCKWLKMELPPLLDQIRKKVEPAQSDGVV
NLSRAEAKQAWLTEGSDLERAARQALRDRLAKVKELSELGFSDEAQCHEVLRQSGGEVRG
ALVLLQRPLLEGFHKRIWSDKPDPPVDIHHPDKQHICRRLLAVYDLPSWGRCELALSLLL
EENAPYSLEDVVQAVRESHDREFIKRVLTKECPICLSIFPHSKMQSLTSCQCSVCCDCFQ
QHFTIVVRDKHIRDMVCPVCWEPDINDPEHLNSYFSTLDIQLRECLDSEVYELFHKKLTE
QALIKDPKFLWCCHCSYGFIYDGDQLKVTCFQCRNSFCAQCKKPWESQHAGLSCEQYQSW
KRENDPEYQRQGLAGYLRDNGITCPNCRFQYALSKGGCMHFCCSQCRYQFCSGCNNPFHT
TCAVEECSVSGLHAHHPRDCLFYLRDWEPSRLQALLQNSGVSFNTELPPGTQTIKAGLCG
VIEQKDEGGQQSDTACGAQTQPGHAGLCEKHYREYLVSLINSHSVYPAPLYSSSELLLAC
KRYKVEEARRDGEDSFTYYSRLLEKLMDEVPLGDKVPRKK
Download sequence
Identical sequences H3DLA4
ENSTNIP00000021302 99883.ENSTNIP00000021302 ENSTNIP00000021302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]