SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021327 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021327
Domain Number 1 Region: 749-946
Classification Level Classification E-value
Superfamily vWA-like 6.08e-42
Family Integrin A (or I) domain 0.00098
Further Details:      
 
Domain Number 2 Region: 5-197
Classification Level Classification E-value
Superfamily vWA-like 1.18e-29
Family Integrin A (or I) domain 0.0057
Further Details:      
 
Domain Number 3 Region: 1048-1099
Classification Level Classification E-value
Superfamily BPTI-like 7.66e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021327   Gene: ENSTNIG00000018161   Transcript: ENSTNIT00000021562
Sequence length 1101
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:16143444:16151371:1 gene:ENSTNIG00000018161 transcript:ENSTNIT00000021562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSASTCPVEIMFIVDSSEKAKFALFEQQKQFVLRFSTKLMELHPLAWRVRLRLAILQYSS
TVSVEHNFRDWQDVDVFQGRVASMSFIGHGTYSAYAIANATQLFSQETSSNSLRVALLMT
DGVDHPRSPSAVTAAAEAKQHSIRLFAISLLGLPDQGPAGTKLRSIASTPPQQHVISFTD
GRLDDRLLGQLNSIVKSQCPQPKLCLCEKGDRGLPGNPGKPGEPGSDGVPGPKGSRGQPG
INGRPGIEGLEGQSGSKGDKGEPGECGPPGLKGEKGADGPPGSRGLKGEQGLRGAPGDQG
PEGPPGSKGDRGQRGATGPPGDKGFGFPGPKGERGIQGRVGPPGPVGQGEPGTPGPAGPP
GIQGPPGLPGEGLLGSKGDRGFEGPKGARGPPGVGLKGEKGNTGAPGVPGLMGFPGVGIQ
GDKGEQGLTGPSGPRGPPGLAIIGSKGDQGFPGDPGPQGPRGVGEPGPKGEPGPDGPAGT
PGIPGEDGASGPKGETGAPGPRGPEGALGKGVPGEKGDRGDRGPRGLPGSPGPAGSAGPK
GEPGSPGMTGPPGSPGRGLPGPKGESGPAGAAGPLGEPGVGATGPKGNRGNPGAAGPPGE
KGDSFPGPPGPPGPPGAHGETGPEGKGIPGSKGDRGLPGPPGPSGPPGTGFYGPKGSVGQ
HGPPGPPGPPGEGIQGPKGEPGFLGPMGPRGAPGDSLPGEKGDRGTPGARGRRGQKGDFG
EPGSPGQMQGRPGEKGDAGLTREEVVRLIRELCGCGFQCRAAPLELVFVIDGSESVGPNF
ELVKDFVNALVERVWLSQEAARMGVVLFSHTSLAVASLQPRSSLSELKATVRSMPYLGEG
TFTGSAIHRAHQLFQASRPGVRKVALVLTDGQADPRDVVQVGVSAAEAQARGIEMFVIGV
MNESHPLYPDFSAEMKAIASNPKEGHVHLIQDFGSLHACLGAVLEKVIVNQICEQNAAVA
FLPKVPPVEFQSQTPGSRMQKEDGRQTDTHPDDRDLLLIPEVTFTSAPDPGLTSTTGVQT
PGRWMHEGAATPPPPPTTTEPTPAGLGCGQPLDPGPCRQYVVRWYYDAEANSCAQFWFSG
CQGNANNFDSEAKCKHFCVFT
Download sequence
Identical sequences H3DLC9
ENSTNIP00000021327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]