SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021355 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021355
Domain Number 1 Region: 223-413
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.07e-41
Family Pentraxin (pentaxin) 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021355   Gene: ENSTNIG00000018189   Transcript: ENSTNIT00000021590
Sequence length 424
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:16460675:16464008:-1 gene:ENSTNIG00000018189 transcript:ENSTNIT00000021590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLMFCSFLTCAAAAAGSLPGIDHDYGISPKFVCTPIPPEADPSCYSSTYGAPHEAKATIL
HLRESLVRQKETILDQRETIRELTAKLTLCEGFGGHHSSGGHRPEPHHRKGPAHAKHGSF
SPEQTGKTLQTLKERLENLQEAAARNSSSSYSSSLRELLQRKIAALEEQLHSYHTEHHDY
DGGGRHDDHHGHGKLEAVLGQLHHSNDEHGNHQKLQRSGAFLLDFPMRTNYLYARMRRSL
LKEIFALTICLWVKPGSGPGLGTPFSYAVPGQANELVLIEWGGNPMELLISDEVKAVTLP
VTMTDGKWHHVCVTWSTRDGAWEVYQDGVRKGSGQNLAPWHAIKAGGVFILGQEQDTMGG
RFDVTQSFTGQLSDLQFWSRVLTTNEIHKQATCASHLTGDVVSWAEESVELHGGLAELPF
DPCH
Download sequence
Identical sequences H3DLF7
99883.ENSTNIP00000021355 ENSTNIP00000021355 ENSTNIP00000021355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]