SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021374 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021374
Domain Number 1 Region: 202-379
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.000000135
Further Details:      
 
Domain Number 2 Region: 74-174
Classification Level Classification E-value
Superfamily PH domain-like 1.83e-17
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 3 Region: 465-561
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-17
Family SH3-domain 0.0000804
Further Details:      
 
Domain Number 4 Region: 2-97
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.23e-16
Family BAR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021374   Gene: ENSTNIG00000018208   Transcript: ENSTNIT00000021609
Sequence length 562
Comment pep:known_by_projection chromosome:TETRAODON8:7:9820860:9830601:1 gene:ENSTNIG00000018208 transcript:ENSTNIT00000021609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDFVEPLLAFLQGLFTYYHHGYELAKDFNHFKTELTISIQNTRNRFESTRSEVESLMRK
MKENPHEHKSVSHHTMEGYLFVQEKRSFVSTWVKYYCTYHREPKRVTMVLFDPKSGGKMG
EEESFILKSCTRRKTDSIEKRFCFDVEAVDRSPGVITMQALSEEDRRLWMEAMDGREPVY
NLNKDNQAEGMAQLDVTGFNVMKKFIYAVETRGIDEQGLYRIAGVNSRVQKLLSLAMDPK
TCADVELENHEWEIKTITSAIKHYLRMLPAPLMTYQYQRSFIKAAKLDNPEARVKEIHAL
VHRLPEKNRQMLELLMNHLANVASHDQHNLMTVANLGVVFGPTLLRPQEETVAAIMDIKF
QNIVVEILIEHHERIFSDVPSPATGPSNLQLNLSRRKSTDSKAPSCSERPLTLFPTPTHS
LKGEKRDSLANATVAEPPSADGRTPRHSLNSNDAEQDARHTRPSSLAPSPSPTSPRSPSW
PMFSAPSSPQRISSASSDSSPVSTAGKKARALYACKAEHESELSFIAGTIFENVHASREP
GWLEGTLDGRTGLIPENYVEIL
Download sequence
Identical sequences H3DLH6
ENSTNIP00000021374 ENSTNIP00000021374 99883.ENSTNIP00000021374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]