SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021392 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021392
Domain Number 1 Region: 23-146
Classification Level Classification E-value
Superfamily PX domain 1.44e-28
Family PX domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021392   Gene: ENSTNIG00000018226   Transcript: ENSTNIT00000021627
Sequence length 159
Comment pep:known_by_projection chromosome:TETRAODON8:7:10182500:10184296:1 gene:ENSTNIG00000018226 transcript:ENSTNIT00000021627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEVADTRRLNSKPQDLMDAYGPPSNFLEIDVNDPQIVGVGRNRYTVYKVRMKTNLPIFK
LKDSCVKRRYSDFEWLKSELERDSKIVVPALPGKALKRQLPFRPDEGLFEESFIEERRGL
EQFINRIAGHPLAQNERCLHMFLQEEAIDRDYIPGKVRH
Download sequence
Identical sequences H3DLJ4
ENSTNIP00000021392 ENSTNIP00000021392 99883.ENSTNIP00000021392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]