SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021398 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021398
Domain Number 1 Region: 28-183
Classification Level Classification E-value
Superfamily C-type lectin-like 6.7e-24
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 2 Region: 347-454
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000204
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 3 Region: 252-378
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021398   Gene: ENSTNIG00000018232   Transcript: ENSTNIT00000021633
Sequence length 454
Comment pep:known_by_projection chromosome:TETRAODON8:7:10233349:10235511:-1 gene:ENSTNIG00000018232 transcript:ENSTNIT00000021633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSCVGLLWVLWLLICLAPGSRGQRSKKNAICHQDSCYAVFLQKRTFREAGRSCRELYGT
LATMHTGEAAGVVHQLLSRMEVQSGRLRLRLWIGLHRPPRQCSTSRPLRGFVWVTGDQDG
QFTNWLREDTPGTCAAPRCVAMTVHTSESGREVGDNFRWLDGSCALPLDGYVCQYNYKGM
CPPLEDEGGGAVVYTTPFRLVSSLLTHVPYGSVATVFCPADQSDPDAPAQHTVLCTERDD
KAVGWQRETPLCTPGATVENQDWCSGDHGCEQFCQNTDTDYYCYCSEGFVIDEDGYGCKP
DPVCVDMGCEYDCVETPRAVRCTCPPGYQMGPDGRRCSDVDECRQQPCPQLCVNIPGTFH
CTCHAGYQPDDEGECVDIDECLDEGSCPGTCENTVGSFRCVCNPGFELGRGGECVDVDEC
VGESPCQQQCINYVGGYQCLCDNGYDLQPDGLTC
Download sequence
Identical sequences H3DLK0
99883.ENSTNIP00000021398 ENSTNIP00000021398 ENSTNIP00000021398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]