SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021403 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021403
Domain Number 1 Region: 45-189
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.2e-17
Family SPRY domain 0.049
Further Details:      
 
Domain Number 2 Region: 234-330,377-413
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-16
Family SPRY domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021403   Gene: ENSTNIG00000018237   Transcript: ENSTNIT00000021638
Sequence length 420
Comment pep:known_by_projection chromosome:TETRAODON8:11:7888955:7896988:-1 gene:ENSTNIG00000018237 transcript:ENSTNIT00000021638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKNQRTTRYKFRNNMGDVNHYRIRRIREIREARRVRRRGQLSRMLKDGDVLRYHGNSDEV
GCFMAARPFSRGYRYFEVTIIDTGVRGMIAVGLVPKLYDLDHQPGWLQHSVAFHADDGKL
YNGNTVGQQFGPKCCRGDKIGCGITPDSEDGQVTVFFTKNGKEVGSVEIAASLDTLYPAV
GMHSLGEEVLLDLNAEWGTEEDDGQMIVDSHEDDWSCLHDVRLTGTLLKYVGKGKSIVDV
GLAQARRPLNTRFHYYELEITDAGEKCYIALGLARRDYPKNRHPGWSRGSIAYHADDGKL
FHGSGVGDPFGPRCFEGDVMGCGIMFPRDFSTDVSDDTDDWDFEVFSKPSEVQNDLYASN
EDEDGEGEDVDGKKVMVFFTRNGKLVGRREVALPAGGLYPTIGMMSTGEKVRVDLHPLSG
Download sequence
Identical sequences H3DLK5
ENSTNIP00000021403 99883.ENSTNIP00000021403 ENSTNIP00000021403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]