SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021405 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021405
Domain Number 1 Region: 612-724
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.19e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00032
Further Details:      
 
Domain Number 2 Region: 86-240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.17e-28
Family G proteins 0.00000431
Further Details:      
 
Domain Number 3 Region: 347-421,552-595
Classification Level Classification E-value
Superfamily PH domain-like 6.64e-18
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 744-842
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000207
Family Ankyrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021405   Gene: ENSTNIG00000018239   Transcript: ENSTNIT00000021640
Sequence length 887
Comment pep:known_by_projection chromosome:TETRAODON8:11:7906497:7914214:-1 gene:ENSTNIG00000018239 transcript:ENSTNIT00000021640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKRGKEAQDGTVQRAPPRDRKMLKFISGIFTKSAAAPFGQRGGLSVPEKVFESSVSAHWL
RPNMTRAQPKAVCTSTQEWTMSQTIQELHLGVLGGRCSGKSALVHRHLTGSYLQLENTEG
RQYFKDVLVDGQSHLLIIREETELPGAQFASWVDAVILVFSLENEASFQEVYKLYHQLAV
HRPIAEIPFVVVGTQDKISSTNPRVIDDARARQLCSDVRRCTYYETCATYGLNVNRVFND
DSTAAQKIMTAKKQAALLASCKSLPNSPTHSGGSTPVSGQASNGGQSSDYSSSLPSTPVI
SHKDLNRSSKGEKQDSGTPGSVRSATRRRAPRFAGRRGSDSNRRSADFKGDLGSGRSIPI
KQGILLKRSGNSLNKEWKKKYVTLSNDGILSYHASVNDYMLNVPGKEMDLLRVTVKVPGK
RPPRAVPPSGLPGGLNGRVKDAQGPEGLSPVPVSASSILQVEEMEGLGGPLLLRSNRGVQ
RCPSTVSNHAQSVGELEKVTLQSPLTDRKKHRRKKSVNQKGDAASGPADAKRKMWKLKSF
GSLRNVSKTDEENFDFLIVSSSGQTWHFEAQSVEERDSWVQAIESQILASLQLCESSKNK
ARRNSQSEAVALQAIRSAKGNSFCVDCSAPNPTWASLNLGALICIECSGIHRNLGTHLSR
VRSLDLDDLPWELTLVLRAIGNHMVNSIWEGRTLGRRKPAPDAPREDRESWIRAKYEQKL
FVAPLPPPTPGEGPDITLSGRLLLAVMERNLPKLLLLLAHCTKEDINGPLSRALSARSLF
ALRLPGSALHAACQQGDVVMTQLLLWYGCDVRVRDAQGQTALALARGAGSQECVDVLLQH
GCPNEPAAALCFAGAASSGLTVSSTLKLSHKSSSPSLTYSTSRRAVS
Download sequence
Identical sequences H3DLK7
ENSTNIP00000004004 99883.ENSTNIP00000021405 ENSTNIP00000021405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]