SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021474 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021474
Domain Number 1 Region: 22-64
Classification Level Classification E-value
Superfamily UBA-like 0.0000112
Family TAP-C domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021474   Gene: ENSTNIG00000018308   Transcript: ENSTNIT00000021709
Sequence length 283
Comment pep:known_by_projection chromosome:TETRAODON8:11:8946778:8948877:1 gene:ENSTNIG00000018308 transcript:ENSTNIT00000021709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTDMDVDAELMQKFRCMGTTDKDVLISEFQKLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPIANTPSMSFVEDVTIGEGESVPPDTPFTKTWRIQNTGTDAWPPGVTLKYIGG
HQFGHVNTVMVKSLDPQEISDISVQMRSPAAPGMYQGQWRMCTATGLFYGDVIWVILSVE
VGGLLGVTQQLSSFETEFNTQPQRNVQEDFNPFASPQKNKCDTADSSFTEPSGAWDRTRE
PNRQDQNGLSHNAVNRASNGLQSNLSVVTYGQGIHGPYPFGQS
Download sequence
Identical sequences Q4RIE8
ENSTNIP00000021474 99883.ENSTNIP00000021474 ENSTNIP00000021474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]