SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021483 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021483
Domain Number 1 Region: 22-194
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000000127
Family RUN domain 0.0063
Further Details:      
 
Domain Number 2 Region: 327-347,378-431
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000276
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021483   Gene: ENSTNIG00000018317   Transcript: ENSTNIT00000021718
Sequence length 433
Comment pep:known_by_projection chromosome:TETRAODON8:8:8207690:8211701:1 gene:ENSTNIG00000018317 transcript:ENSTNIT00000021718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESETQNGTNAMSDTPPVLVGAVSDAVEAILGQFSASRTVVQKTLSGDSTINPALGRLVLQ
CLCPALHSLLTDGLKPHQSDLIAGRRPNSAWGLVQASTRPGPKTQILFNLQVRVSELPQL
RHSKQRFNAFLLGLLNTKFLDFWLSHLHSCTDVLETYYQPASFMRLSLTACRPLFEELLL
VLQPLSLLTFNLDLLFQHHRLEPDCHSPDMPSPPCQETGFQLRSQSKSRYIESLSAFNYG
SSNPQTARGTPSPQAHPKNQAVESTDGGAERQNLPGPLGHTSPQLLWVQEKEIGALPPPD
LEEDGFVQQAGQVPWGLGRLFGASKSPSSPQGHTPPSRRPSQWLAPGVSALTRMRRFSET
LEEPEAEDNNQGDAVEIKASVRTLCDHAGTGSELTFCKGEELVVLGGVDQDWIRCRQGDR
EGLVPIGYTSLIM
Download sequence
Identical sequences H3DLT5
ENSTNIP00000021483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]