SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021489 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021489
Domain Number 1 Region: 161-278
Classification Level Classification E-value
Superfamily PX domain 1.96e-25
Family PX domain 0.0012
Further Details:      
 
Domain Number 2 Region: 37-146
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-25
Family PDZ domain 0.0062
Further Details:      
 
Domain Number 3 Region: 282-349
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000327
Family First domain of FERM 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021489   Gene: ENSTNIG00000018322   Transcript: ENSTNIT00000021724
Sequence length 548
Comment pep:known_by_projection chromosome:TETRAODON8:8:8115049:8119071:1 gene:ENSTNIG00000018322 transcript:ENSTNIT00000021724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDVDGQGTCSPPSPLPHPSTLTCSSSGNVTPGTGSSSCQTATTVTSGPRLVRIVKSDSG
YGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGISKGDRILEVNGVNVEGA
THKQVVDLIRAGERELVLAVLSVPPQEADCLDPGDDVSAQSCYDYSDKQAVPISVPSYKH
TELNQEKFVVYNVYMAGRQLCSKRYREFVILHQNLKREFDNFAFPKLPGKWPFSLSEQQL
DARRRGLEEYLEKVCSVRVIGESDIMQEFLSDSDENYNGVSDVELRIALPDKTALTVRVR
KNATTDQVYQAVVTKLGMDSVTSSYFALFEVINHTFVRKLAPNEFPHKLYVQNYTSAIPG
TCLTMRKWLFTTEEEVLLNDNQLAVSYFFHQAVDDVKKGSVKSEQKSYQLQKLVEQKKMA
AYLSLLRGCEGYNEIVFPHCSCDSRRKGHIIAAISIHHFKLHACTEEGTLENQVIAFDWA
EMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKENIFQLL
RHRRDGGT
Download sequence
Identical sequences H3DLU1
ENSTNIP00000021489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]