SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021511 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021511
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily vWA-like 9.24e-31
Family Integrin A (or I) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021511   Gene: ENSTNIG00000018343   Transcript: ENSTNIT00000021746
Sequence length 372
Comment pep:known_by_projection chromosome:TETRAODON8:8:7830500:7833235:1 gene:ENSTNIG00000018343 transcript:ENSTNIT00000021746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLESTVVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITMANNCEV
LTTLTPDTARILSKLHTVQPCGNISFCTGIKVAHLALKHRQGKNHKMRIIVFVGSPVEDN
EKDLIKMAKRKKEKVNVDVINFGEQEMNTEKLTAFINCLNGKESTGSYLITVPPGPSLAD
ALLSSPILAGEGSAALGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARLTTVA
SAADAGVSSTVTDESPGTLLKMSAPHLDSSKPALPDFSRMTEDEQVGSALQNILILAEFG
TEDMDTGAEADSSMAKDEEDYDIMQDPEFLQSVLENLPGVDPNNDAIRNAMGSLASQTGN
KPDSQKKDEKKK
Download sequence
Identical sequences H3DLW3
ENSTNIP00000021511 ENSTNIP00000021511 99883.ENSTNIP00000021511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]