SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021535 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021535
Domain Number 1 Region: 581-857
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.7e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000842
Further Details:      
 
Domain Number 2 Region: 77-180
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-30
Family Second domain of FERM 0.00033
Further Details:      
 
Domain Number 3 Region: 178-306
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-29
Family Third domain of FERM 0.00052
Further Details:      
 
Domain Number 4 Region: 454-548
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-18
Family PDZ domain 0.00022
Further Details:      
 
Domain Number 5 Region: 4-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000475
Family First domain of FERM 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021535   Gene: ENSTNIG00000018366   Transcript: ENSTNIT00000021770
Sequence length 859
Comment pep:known_by_projection chromosome:TETRAODON8:8:7638302:7645114:-1 gene:ENSTNIG00000018366 transcript:ENSTNIT00000021770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQDEGVVLLDQVFNHLGLLERQLFSLQIRESGTAVASITANTHSPRWLEPEKPLKKQIKG
LASPFYVNFRVRFFISDPNSLQHEQTRHLYFLQIRSDIREGRLQCPLSAAVVLASYALQS
EMGDHSPSQRPGYTSKCHFIPEQDQDFLSGVEDLHPQHNGLKQSEAELCFLNTARTLELY
GVELHSATNANNVPLMVGLASSGVAIFHNMICSSFFPWGNIIKISFKRKRFLVHLKHKHG
ETQDCEVSLALPSPKNCKNLWRSCVDHHSFFSSNRTARSPKHNNSAVQTYKKLITQHLGL
GNSKAERCPVSSHMFSGPVCQRVVGGMVWNPVLRRSVSSEHLETKSLPSRSPPSTPNWRS
PRVRHGICKPRPSSVELSSDLKDMSEGEDVFYTYRASVSSSKDGEEAAANLSGSHEADET
LLHTDDSVGEEDGDHSLPHYKKVLPFPRGALGDGDLMLICIAPDKDGKFGFNVKGGVDQK
MPLSISHVKADSPAGRCEPALMEGDLVVLINGRDISEHTHDQVVMFIRASRESHSRELAL
LIRRRGPGRVAPLLQLQLPSALTLPDQSATERLHSSGPSGKVVTLEESMRQLERGTQSGT
LSFHFENLHRRKPGLFQNCARLPENTDKNRYRDVLPYDSTRVVLQGQENYINASHITVAP
PVSGTRLRYVAAQGPLPQTCTPFWQAVWEQQIHTIIMLTTLTERGRTKCHQYWPHPPEVK
EYGHLRVKCHSEECNLVYVTRHFTLTHTQRGEERAVTHLQYVAWPDHGVPDDPSDFLLFA
TSIGERRRGDEPLMVHCSAGIGRTGVLITMETALSLLDRGRPVFPLDIVKTLRDQRAMMV
QTTSQFQFVCEAILRVYRE
Download sequence
Identical sequences H3DLY7
ENSTNIP00000021535 99883.ENSTNIP00000021535 ENSTNIP00000021535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]