SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021540 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021540
Domain Number 1 Region: 377-501
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-23
Family Cadherin 0.002
Further Details:      
 
Domain Number 2 Region: 601-721
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-20
Family Cadherin 0.0055
Further Details:      
 
Domain Number 3 Region: 115-188
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000942
Family Cadherin 0.002
Further Details:      
 
Domain Number 4 Region: 489-585
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000113
Family Cadherin 0.003
Further Details:      
 
Domain Number 5 Region: 312-389
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000681
Family Cadherin 0.0061
Further Details:      
 
Domain Number 6 Region: 707-806
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000157
Family Cadherin 0.0051
Further Details:      
 
Domain Number 7 Region: 57-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000899
Family Cadherin 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021540
Domain Number - Region: 246-284
Classification Level Classification E-value
Superfamily Cadherin-like 0.0327
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021540   Gene: ENSTNIG00000018371   Transcript: ENSTNIT00000021775
Sequence length 867
Comment pep:known_by_projection chromosome:TETRAODON8:8:7571136:7576423:-1 gene:ENSTNIG00000018371 transcript:ENSTNIT00000021775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPVLLLLPLLFSAAGGKDLEEQKGPFRDIQLVVAEAAPVPYALYQFLVPNHIDSFRLS
GEGKGEFEMSSDGWLYVQRPLDWSREDHYVMMIEALAGDQVVDGPVYVTVSVLDINNNPP
SFNQSVYTAWVRERTPAGVPFTHVFAEDKDDPTTPNAALLYTLVSQIPSRSNVPFFQIDP
ETGAISTTEEGQQMLKAREGIRYSRGEEQTIETLRTKFNSYCPVQNIPYEQNPFYTCVER
AELRKRNVDPLSDPDYTLIVRAQDLGGRSNTALSGNTRVQIVVLENLWVNPGPLVVMEHL
AVVYPLVIAKVQSNNPEAVYTLMQKERELRFPFQITEDGEIQLTEELDREDKNMYILVVK
ATDHHGNNVDPPMEIVISVGDVNDNPPRCEHQESIFEVQEQEPIGSVVGQLLVYDADEEQ
TLNSQLTYAIVRQLPDPRRRPFSIDAASGEIQVLRVLQRKELKLYELTVNASDPDFSTEC
KVLIKVIDVNNEVPVFEKTDYGSHTVAEDTPVGHTLLTVMATDNDEPDSGSSIIQFHISS
GNQDGYFAVETNGTGVGHVVVAKPLDFEASPTLQLQIDARNPEPLMKGLDYGDESSTFVL
VSLTDVDEAPEFSLDLVDVAVPENITQGSVLLTAEAKDPEGKEISFKLDGDTQDWLEIDA
STGEIKTKAKLDRETLETFEVKVTAFEKNNPKMSAESVVNVRLLDVNDNVPRLVEKEVFI
CARKPEPVILTATDGDDPPFAQPFTFVLGSGKKSPNWDLSSVDGSTAKLTLKKIPTEEIT
VTLPVNIKDHAGMGVTHALSVRVCNCTALGYCYTAPASRGHMGPGATAIILVGVLLFCGI
VFFMVTRQIKKGNKKKADAAREEEKRV
Download sequence
Identical sequences H3DLZ2
ENSTNIP00000021540 ENSTNIP00000021540 99883.ENSTNIP00000021540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]