SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021546 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021546
Domain Number 1 Region: 18-358
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.67e-58
Family Ankyrin repeat 0.0000377
Further Details:      
 
Domain Number 2 Region: 285-549
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-54
Family Ankyrin repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021546   Gene: ENSTNIG00000018377   Transcript: ENSTNIT00000021781
Sequence length 638
Comment pep:known_by_projection chromosome:TETRAODON8:8:7516280:7521694:1 gene:ENSTNIG00000018377 transcript:ENSTNIT00000021781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQASAVSGPGPSSLGSQVHAAAVNGDRSSLLKLIAAEPSLRDHEDQFGRTPLMYCVLADR
LDCAEILLKAGASVNKTDHSRRAALHLAAQKGNIRFLKLLLSRRANWLQKDLEEMTPLHL
ATRHPSPKALALLLKHIGPGEVDTQDKNKQTALHWSAFYNRPEHVRLLIKHDSNIGIPDS
EGKIPLHWAAHSQEASATQTVRCILEAAPTESLLNWQDYEGRTPLHFVADGNEAVVKVLT
SYQGCNVTAYDNLFRTPLHWAALLGHARIVHLLLERNTSGTIPSDSQGATPLHYGAQSNN
AETVRVFLSHPSVKDEPDLEGRTAFMWAAGKGSDDVIRTMLGLTPHIDINMADKYGGTAP
ALHATSLSGHVSTVKLLLERGAMVDSLDVMKHTPLFRACEMGHRDVILTLIKGGAQVDLV
DVEGHTALHWAALGGNAEVCQILMENGISPNVQDQAGRTPLQCAAYGGYITCMAVLMENN
ADPNIQDKEGRTALHWSCNNGYLDAVKLLLGYNAFPNHMEHTEERYTPLDYALLGGHSEV
TQFMLEHGALSIAAIQDIAAASIQAVYKGYTVRKAFRERKQLLMRHEQLRKDAAKKREEE
QRRLKEPLSQSGCSQPPGLRPRPPSTPRVREQPRPTSR
Download sequence
Identical sequences H3DLZ8
ENSTNIP00000021546 ENSTNIP00000021546 99883.ENSTNIP00000021546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]