SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021559 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000021559
Domain Number - Region: 175-211
Classification Level Classification E-value
Superfamily UBA-like 0.0204
Family UBA domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021559   Gene: ENSTNIG00000018390   Transcript: ENSTNIT00000021794
Sequence length 213
Comment pep:known_by_projection chromosome:TETRAODON8:8:7263256:7266620:-1 gene:ENSTNIG00000018390 transcript:ENSTNIT00000021794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPGNDGNTDPQVEAKMPVPQGEGQGKAEESESEESVPELEESEPLRLSEPRSVATAEDGP
NRPKQSRSEKKARKAMSKLGLKPVYGVTRITIRKSKSILFVISRPDVFKSPASDIYIVFG
EAKIEDLSQQAHKAAAEKFKVPVTSSPLSPPAPPSLTIKEESEDEVEEVDDGGLEQRDIE
LVMAQANVSRAKAVRALKHNKNDIVNAIMELTM
Download sequence
Identical sequences H3DM11
ENSTNIP00000021559 99883.ENSTNIP00000021559 ENSTNIP00000021559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]