SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021595 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021595
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily PX domain 8.24e-33
Family PX domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021595   Gene: ENSTNIG00000018426   Transcript: ENSTNIT00000021830
Sequence length 175
Comment pep:known_by_projection chromosome:TETRAODON8:8:6821875:6822752:-1 gene:ENSTNIG00000018426 transcript:ENSTNIT00000021830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVLSIWVRDPRRQKNDFWHAYVDYEICLHTTSVCFTKKISCVRRRYSEFVWLRQKLQA
NSIPMAKLPNLPPKNPFFSLNNAQQIAERMKGLQKFLEQILQNPVLLSDSCLHLFLQTQL
SVSRIEACAAGRSRYSVAQALQGSGLRRFHSIDGLQQSPSSSCDCDSDRYSHTLL
Download sequence
Identical sequences H3DM47
ENSTNIP00000021595 ENSTNIP00000021595 99883.ENSTNIP00000021595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]