SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021608 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021608
Domain Number 1 Region: 12-320
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.87e-87
Family Ankyrin repeat 0.0000113
Further Details:      
 
Domain Number 2 Region: 282-639
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.64e-78
Family Ankyrin repeat 0.0000127
Further Details:      
 
Domain Number 3 Region: 552-903
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.05e-77
Family Ankyrin repeat 0.0000156
Further Details:      
 
Domain Number 4 Region: 880-979
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000174
Family Ankyrin repeat 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021608   Gene: ENSTNIG00000018438   Transcript: ENSTNIT00000021843
Sequence length 1053
Comment pep:known_by_projection chromosome:TETRAODON8:8:6673613:6684580:1 gene:ENSTNIG00000018438 transcript:ENSTNIT00000021843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLKIRDQPALLKAIFNVDPDEVRSLIFKKEDVNAQDNEKRTPLHAAAYLGDAEIIELL
ILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAV
RCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKRDRRAIHWA
AYMGHIEVVKLLASHGAEVACKDKKSYTPLHAAASSGMISVVKYLLDLGVDINEPNAYGN
TPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVN
IKSKDGKTPLHMTAIHGRFSRSQAIIENEGAEIDCEDKNGNTPLHIAARYGHELLINTLI
TNCADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLE
CLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAA
ASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGT
DILNDSDVRAPVSPLHLAAYHGHHHAVEVLVQSLLDLDVRNSQGCTPLDLAAFKGHVECV
DVLINQGASILVKDFNLNLTPIHAAATNGHSECLRLLIGNSDLQSAVDIQDGNGQTPLML
SVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECVEALLQHSANFLAQDCKG
RTPIHLAAACGHIGVLGGLLHAAQSLETLPVLTDSQGYTPLHWACYNGHDTCVEVLLEHE
VFHKAEGNTFSPLHCAVIHDNEGVAEMLIDTLGPAIVNTKDGKNRTPLHAAAFTDHVECL
QLLLSHNAQVNSVDAAGKTPLMMAAQNGQTNAVELLVSSAKADFTLQDAAKNTALHLACS
KGHETSALLILEKITDRNVINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENG
YTPALACAPNKDVADCLALILATMMPVSPCTTAPTLSFSAINHYTTSPPKSVTFDSLPVL
RGEHSSYCSFNNISHHDGIYKDEELNDSDSETY
Download sequence
Identical sequences H3DM60
ENSTNIP00000021608 99883.ENSTNIP00000021608 ENSTNIP00000021608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]