SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021627 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021627
Domain Number 1 Region: 314-415
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-32
Family Third domain of FERM 0.00000688
Further Details:      
 
Domain Number 2 Region: 208-315
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-30
Family Second domain of FERM 0.00000352
Further Details:      
 
Domain Number 3 Region: 128-207
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-25
Family First domain of FERM 0.0000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021627   Gene: ENSTNIG00000018453   Transcript: ENSTNIT00000021862
Sequence length 783
Comment pep:known_by_projection chromosome:TETRAODON8:8:6426193:6441793:1 gene:ENSTNIG00000018453 transcript:ENSTNIT00000021862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEQLKPRTRISAGKGLSRLFSSFLKRRSQCSDDDGPEEDKVKEEKEPSKTLTKRGLSEAQ
MKAPIAAPEPELKTEPDIEQAPDQLSVSSAEMQPPQEEQKDAGITVKDKKAEKKSEEAKG
SKRQKTIQCKVVMLDDSQFECELDKHAKGQELLTKVCDHINLLEKDYFGLANWETPNSKT
WLETTKEIRKQVPGSVYEFTFSVKFYPPDPAQLSEDLTRYYLCLQLRKDIMRGVLPCSFV
TLSLLGSYAAQSELGEYDPEVHGTDYVKDLSLAPGQSKELEEKVMELHRTYSLRSMSPAQ
ADLLFLENAKKLAMYGVDLHQAKDLDGVDITLGVCSSGLMVYKDKLRINRFPWPKVLKIS
YKRSSFFIKIRASEQEQYESTIGFKLPHYKASKKLWKVCVEHHTFFRLRERDDLERSLRT
TPAVEYQEVEQTNKKTVRIVETPEMMFEVAVSQRAEEPLVDSASMVVSTQRGTRPVSAPV
FSQAALAEAGIPFDQPQTSTPIKTTRKEERKLEVTVEAVEPSKIESVADIKTAVWRDEQE
PYSSLVSTINGDTQHESETSTEVVRLRKKKRKKIEADSIYIRHSLLMLEDFDKPNEDLVK
HHASISELKRNFMEAVPESRPSEWDKRLSTHSPFRSLGINGQPLPGADGPPLVQTQRVTI
TAESNSLPSADVPVVPTQTIIYESSKEPDEGTEKDSMTVSSSTSITSETTSGTTVTTTTT
HISKVVKSGSTETRMEKRIVITADSDADQDKVSVTTISQCRFQHQGPAHTKYIVYQHVSF
GGA
Download sequence
Identical sequences H3DM79
ENSTNIP00000021626 99883.ENSTNIP00000021627 ENSTNIP00000021627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]