SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021658 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021658
Domain Number 1 Region: 22-362
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.33e-57
Family Ankyrin repeat 0.0000276
Further Details:      
 
Domain Number 2 Region: 476-529
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000458
Family SOCS box-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021658   Gene: ENSTNIG00000018484   Transcript: ENSTNIT00000021893
Sequence length 531
Comment pep:known_by_projection chromosome:TETRAODON8:19:4007100:4010272:1 gene:ENSTNIG00000018484 transcript:ENSTNIT00000021893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRLSAGDVCRLQQRAAHLSAFRERDSRGRLPLHVAALRPQTDVLRVVLQATASTDLTLEE
RTGEGDTPLTLAAAAGLVDNVRILLGHGASPHNTNSCNESPLLIAVRQRSYDMVQSLVLG
GAFVEQVCLTKWTATHEAAKVGCTDILKLLLRHGAKVSSRDAHGVTPLAIAAERGNTEAL
DVLVRHGGDVKAQATNGDSVLYDAAGSGNVDSVELLLGHGADPNVASAFQLPIHRAAYEG
HILVLRTLIPITTERAIHLSGQDPIHSAADGGQVECLRLLIQEGRDVNASLGTHISENYG
DLRKTPLYFAVSNGDVTCAKVLLAAGARTDLDPLRCVLVAVRAERHDLVRLLLSYGADVN
CYFRVISNTLFPTALQYCLSDHVMLRLLLNAGYQAYKCFQCCHGDDGGAESRWTDLRNQA
YQIYSQPDVITFCEFLSVSWLTHLVGGVVRTLLDYVGYVSICPKLRRILKTRPEWEEISD
ILSNPRSLQHLCRLAIRGNVSLKVLNDPGAVAALPFPPTLKNYVTFGGYTQ
Download sequence
Identical sequences H3DMB0
99883.ENSTNIP00000021658 ENSTNIP00000021658 ENSTNIP00000021658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]