SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021670 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021670
Domain Number 1 Region: 191-419
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.03e-81
Family Fibrinogen C-terminal domain-like 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021670   Gene: ENSTNIG00000018496   Transcript: ENSTNIT00000021905
Sequence length 424
Comment pep:known_by_projection chromosome:TETRAODON8:19:4296428:4302658:1 gene:ENSTNIG00000018496 transcript:ENSTNIT00000021905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PINSHQRWDTKGPYSVGSESGSATSCPIKLRPSGQCGSSGAGAEDEDCPYQLTLPPLTIQ
LPKQFRLLEKAMKELQSLKEVVNKLRSGCQDCRGAGSNGPAGNQKNTPVPNNLQEMQVKL
NRMSVSLRNARSQISALHGRLEGLNLLNINNVQAMVKTQVENITSAVNKLSSTCNTACPV
QNSPQSNLSDMVAPRDCSDYNVLEAKKNGVYRVTPDPRNGTFEVFCDMESFGGGWTVIQQ
RLNGSISFNRTWAEYKKGFGGLRGEFWLGNDHIHLLTKAKDMILRIELEDFEGVREYAKY
DQFYVANEFLRYRLSVSGYSGTAGNALNFNKHFNHDQKFFSTPDRDNDLYPSGNCGAYYS
SGWWFDACMSANLNGKYYHKRYKGVRNGIFWGTWHNMTTEYYPTNYRQAFKTVKMMIRPK
NYAP
Download sequence
Identical sequences H3DMC2
99883.ENSTNIP00000021670 ENSTNIP00000021670 ENSTNIP00000021670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]