SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021733 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021733
Domain Number 1 Region: 1737-1984
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.91e-52
Family Ankyrin repeat 0.0000000668
Further Details:      
 
Domain Number 2 Region: 352-484
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000832
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 770-900
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000314
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 1085-1231
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 201-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 1-140
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000377
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 7 Region: 666-709
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000598
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 8 Region: 541-670
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000942
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 169-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000322
Family EGF-type module 0.017
Further Details:      
 
Domain Number 10 Region: 513-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 11 Region: 1055-1098
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000877
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 12 Region: 896-1015
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000091
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 13 Region: 701-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000857
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 133-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000328
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 15 Region: 1303-1339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000982
Family EGF-type module 0.016
Further Details:      
 
Domain Number 16 Region: 479-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000173
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 1427-1459
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0036
Further Details:      
 
Domain Number 18 Region: 1350-1382
Classification Level Classification E-value
Superfamily Notch domain 0.000000392
Family Notch domain 0.001
Further Details:      
 
Domain Number 19 Region: 1223-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000547
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 743-781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000124
Family EGF-type module 0.028
Further Details:      
 
Domain Number 21 Region: 1264-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000265
Family EGF-type module 0.015
Further Details:      
 
Domain Number 22 Region: 1027-1063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000429
Family EGF-type module 0.034
Further Details:      
 
Domain Number 23 Region: 1391-1419
Classification Level Classification E-value
Superfamily Notch domain 0.0000222
Family Notch domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021733   Gene: ENSTNIG00000018559   Transcript: ENSTNIT00000021968
Sequence length 2412
Comment pep:known_by_projection chromosome:TETRAODON8:3:11766296:11779716:-1 gene:ENSTNIG00000018559 transcript:ENSTNIT00000021968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCRPGFIGPFCQYLDPCQRSPCLNGAACKSQMVNGVPQYSCVCQRGFRGQDCSLIDACAT
SPCANGARCANSKNHYNCSCPPGFQGKNCRNDIDECRKPGACLNGGLCMNTHGSFRCQCP
PGYSGRTCEVSTLPCAPSQCLNGGTCRQISDHSYECACLPGFEGHNCENNVDDCPGHKCM
NGGKCVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGW
TGDDCSENIDDCATAVCFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVC
DTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYAGP
RCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYMGTYCEVDIDDCESNPCVNDGICRD
IVNGFKCTCQPGFTGSMCQIDIDECASTPCQNGAKCYDRPNGFECRCAEGYEGTLCESNI
NNCQPDPCHHGTCIDGIASYTCSCDPGYTGYRCENQLNECHSNPCQNGGKCVDLVNKYMC
QCQHGTSGTNCEINFDDCASNPCDYGICKDGINRYDCVCKPGFTGPKCNVEIDECASSPC
RNGGTCVDKENGFHCQCPEGFKPPYCYSQVDECASSPCVHGSCRDDINGYRCDCEPGWVG
KNCDLDRNDCLPSPCQNAGTCIDQLNGFTCKCRQGFRGNLCQVNINECGSSPCLNKGTCV
DGAASFTCLCELPYSGPTCAEVLTPCSPNPCANHAVCSHTPDYLGYQCNCQPGWQGQLCN
IDVNECISNPCKNRGTCTNTPGGFLCSCRAGFTGLTCETDINDCSPNPCLNGGSCIDDVN
SFHCSCLAGFTGQRCAVEINECQSSPCENGGTCTDYVNSYTCTCRPGFTGIHCETNIPDC
TESSCFNGGTCTDKINGYSCTCRPGFTGSHCQYEVNECDSQPCLNGGICQDALESFRCSC
PKGFFGNRCQTPVDWCRRSSPCQNGGRCRQKDASFACECTHGWSGRYCDIRRVSCETAAR
QRGIQTDELCHHGGHCVNTGNTHYCKCPDDYTGSYCESQVDHCEDKPCHNGATCRGYVGG
YQCDCMPGYTGQNCEIEINECQSHPCQNGGSCIDLVGHYICSCPPGTLGVLCEINEDDCA
PPPGVHGASPKCLNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSNPCNPSSSLDCIQ
LPNDYRCVCKPGFTGRRCQSRFSVCESQPCQNGGACSVSSISASGYICTCQLGYSGANCE
RSMSCRELPCYNGGSCTITARGARCTCLKGFGGPQCQHRSNEGCSSKPCRNDGLCTEETA
FPYFHCQCQSGWTGKRCEKGVAALEPQAPSCPLAECHDKANNSVCNKECNTLPCHWDGGD
CSLTVNPWSSCAHCYRSFNNSQCDDSCNNAECLYDNFDCKAKEKVCNPIYETYCIDHYAD
GQCDQGCNTEECGWDGLDCAGKVPENLANGVLVLVVLLPPEELLRSSTAFLQKLSVILRT
TLRFRLDKNGEAMIRPFTRKEARLKRELQPHEEVIGSIVYLEIDNRLCSETCFPTADTAA
KYLGALSASEMLHFPYPLKEVRGESIEDFPPIPEWAKLMLVAIASLFLLIILMIGMLITR
RKREHSTLWFPEGFFLKKEPSSNKNRREPVGQDALGMKHMAKTVEESLLGDHSDQWTDSD
CPEAKRIKVEEPSMLSDSEDAVDSRQWTQHHLAAADIRVPPTMALTPPQGEFEGDCMDVN
VRGPDGFTPLMLASFCGGGFEPEVAEDEENEECSAHIISDLIYQGASLAAQTDRTGETAL
HLAARYARADAAKRLLDAGADANAQDNTGRTPLHAAVAADAQGVFQILIRNRATDLDSRM
YDGSTALILAARLAVEGMVEELITCHADVNAVDELGKSALHWAAAVNNVDATIALLKNGA
NKDMQDLKEETPLFLAAREGGCEAVRVLLAHFANREITDHMDRLPRDIAQERMHHDIVQL
LDEYNTVRSPQGHGGAGHHLTGGHTLSPLMCPPSSFLPNLKTTPQGKKNRRPGAKGSSLG
GQHATSLKESVKARNKKLTLEMQNALLESSVTLSPVDSLDSPHGGATNAGYITNPTSPVA
MQSPGLFHSSMSVPNTPMVHNSMLEGGGPFAVSLAQLGDPGAGGMSMQGRISMASDVNHG
YVLSSGQVGLNMGMVSPVSVPFDWHSRMPPSSQCAQPVVNLIQNSQAAMHPQSPVMQQQS
MLMHQPQMFRSTMLQPTPVTSTPSISPVKLPSIALTHQAITNQQSMARMSTSTPPTPQTS
QAPRPFSQMPQQPSQPQPPAQLPQAAPSAAQPAPALPSQPSVSTAGTEDYPTPPSQHSYS
SALDATPKHYLHLPSEHPYLTPSPESSEPWSSPSPHCVSDWSDSTPSPAVAGPAQTQITQ
VPEAPGKMQMFA
Download sequence
Identical sequences H3DMI5
ENSTNIP00000021733 99883.ENSTNIP00000021733 ENSTNIP00000021733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]