SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021734 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021734
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-37
Family Laminin G-like module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021734   Gene: ENSTNIG00000018560   Transcript: ENSTNIT00000021969
Sequence length 1267
Comment pep:known_by_projection chromosome:TETRAODON8:3:11829124:11851814:1 gene:ENSTNIG00000018560 transcript:ENSTNIT00000021969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDVLKLLEVSENMEGVSLEAGFCTSRTGTEGTDMAYKMDKKIQLIVPTKQLFPDSRFPRD
FSVMATVRAKKGSQFFLLSIYHELGVQQLGLEVGRSPVFLYEDQHGQPTPDMQPIFNTVN
LADGRWHRIAYSVQGKSVTLYLDCQKIETQSLQREEDAVVSTDGVTVFGTRLLDKAVFEG
DIQQLLILEDPQAAARYCVDYIPNCDSALPYSIQAGREVSTASTRSKGKGKGKRKGKGRK
GSRKKKHEEETLQEEGFLSVTTTAPGYGTFQPTEVPHAKNTPETTIPPEVFDQTFMEMPK
LTPNSTTEAPTVMSSPMPETKVSEEREIYDDVTLSTVTVGPNVTEYEMSPEGEKGQKGEP
AITEPGAYMPGPPGPPGPQRRLDGPAGPTGPPGPMGDSGELGPPGRPGLPGADGIRGPPG
TMLMLPFHFAGNSQKGPMTSPQEAQARAILQQTQMSMKGPPGPVGLTGRPGPQGGLGLPG
LKGNRGDSGPSGLRGLPGLVGPKGKMGKTGRTGMDGGRGIPGDPGSKGDRGFDGLPGLPG
NKGHRGDRGKPGLPGPNGQPGEKGANGPVGPRGQPGEPGARGLVGPRGPPGSPGQPGIIG
TDGPQGSKGNQGLAGEIGPQGQQGNPGVEGLPGSQGPIGLPGEKGSQGKQGMPGLPGIDG
PPGHPGREGPAGEKGLQGLPGPQGPVGYPGIRGVKGTDGVRGLKGSKGEKGEDGFPGAKG
DMGIKGDQGDNGTPGARGEDGPEGQKGQAGPLGDTGGPGVAGEKGKLGVPGLPGYPGRQG
PKGSLGFIGSAGVPGEKGRRGPAGPQGTVGQRGPNGVRGERGAKGPTGKPGEKGSAGQDG
PSGSPGERGPQGPQGRHGEPGPRGPNGPPGKDGLPGHPGQRGEPGFQGKNGPPGPTGVVG
PQGKSGETGPPGDRGHPGPPGPPGENGLPGTAGKEGAKGDPGPPGAPGKNGPTGLQGFRG
SRGNPGATGPAGLKGDEGLPGPAGTVGATGERGPAGPAGSIGEPGRPGSVGPAGPMGEKG
EPGEKGPAGPAGRDGQPGPAGLPGAAGPPGPPGEDGDKGETGGTGQKGSKGDKGESGPPG
PAGILGPVGQPGSPGADGEPGPRGQQGMIGAKGDEGQRGFKGLPGPEGLQGMPGLSGEKG
ETGHVGSLGPAGQHGPRGPQGPAGSEGQPGMPGGVGQPGSVGEKGDDGEVGDPGPVGQPG
IIGAKGDVGEKGDSGLPGTAGPPGPRGIPGEDGSKGVIGAVGIPGPTGPPGPPGLSGVVG
EKGSKGE
Download sequence
Identical sequences H3DMI6
ENSTNIP00000021734 99883.ENSTNIP00000021734 ENSTNIP00000021734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]