SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021736 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021736
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.38e-76
Family FCH domain 0.0000000112
Further Details:      
 
Domain Number 2 Region: 340-356,551-607
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000643
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021736
Domain Number - Region: 407-476
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.0235
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021736   Gene: ENSTNIG00000018562   Transcript: ENSTNIT00000021971
Sequence length 616
Comment pep:known_by_projection chromosome:TETRAODON8:3:11935990:11946353:-1 gene:ENSTNIG00000018562 transcript:ENSTNIT00000021971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWGTELWDQYDIIEKHTQSGLELVEKYVKFVKERTEIEQNYAKQLRNLSKKYNPKRSSK
DEPECRLSSYQAFLDILNEMNDYAGQRELIAENMMMSICIDLTKYLQELKQERKTYLLEA
KKAQQSLESTYKQLDSSKKRFEREWREAERAAQYAEKTDQDINATKADVEKAKQQAHMRA
HVAEECKNDYAAQLQKFNKEQNQFYFSDMPLIFNKMQDLDERRVQKLAQGYILFSETEKH
VMPIIGKCLEGITKAGTNVNERNDSMVVIEQNKSGFDRPGDLEFEDYSQGINRASSDSSL
GTPKGPMDILGKNRSKNFWLFSKRSKHGAQTTLSFPHQPSTLPPFSTPPAPSPANGPPSP
KFGRDTLSYCLKEINKTVKPRISSFRTLRRSLSFKPTVTEDFSHLPPEQRRKRLQQKLDD
ICKELQKEVDQSEALGKMKDVYEKNPQMGDPASLASQISQTSQSIERLRGELSKYEIWLA
EAGGRGETLRYKTHAFNNNGAHDIHRYPRSAERRLSIPDGAHSDESAPDASQAIYAEFDD
DFEDEELAAPIGKCTAMYNFPGASEGTIAMQEGEVLAVVEEDKGDGWTRVRRNNGDEGYI
PTSYVTISLNNNTQDD
Download sequence
Identical sequences H3DMI8
ENSTNIP00000021736 ENSTNIP00000021736 99883.ENSTNIP00000021736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]