SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021745 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021745
Domain Number 1 Region: 390-498
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.49e-18
Family Mannose 6-phosphate receptor domain 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021745
Domain Number - Region: 70-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000224
Family LDL receptor-like module 0.0055
Further Details:      
 
Domain Number - Region: 38-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00119
Family LDL receptor-like module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021745   Gene: ENSTNIG00000018571   Transcript: ENSTNIT00000021980
Sequence length 515
Comment pep:known_by_projection chromosome:TETRAODON8:3:12100865:12104785:1 gene:ENSTNIG00000018571 transcript:ENSTNIT00000021980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQCLVWLLLIAGAAAVEVQRPRGVSLSKERQFYEDGKPFTCLDGSKTIPFDRVNDDYCDC
QDASDEPGTAACPNGNFHCTNAGFRPVFIPSSRVNDGICDCCDTTDEYNSGAICQNTCKE
LGRKERESLLKIAEITKEGFLLKQQLIQEAVRGVDDRKAKLEEVRSGKGDLETRVEALRT
IKETAEQPEREAKERHLKAWEDQKAAIRVEKDKARMAQVFLELDEVPDGFVTLGDLLSHP
ELDPDSDGSFTDAEAQGLLGGVDHVDTFGFESVWSNIKDKYTSLVKPSLAPEEPRQDEAP
EPVSDNDSELYPEEDIDYEEDYKGSTSTQTQDKKDDDGEGTMPPYDPQTQELIDAAQKAR
DEFNEAERALREVDDQIRNIEKEISFDFGTESEFTYLYNQCYEMTTSEYVYKLCPFNRVS
QKPKYGGSETSLGTWGKWAGPADNVYSVMKYEHGTGCWQGPNRATTVSLICGTETAVTST
SEPSRCEYLMEFTTPAACQEPQSPDSLYPPVHTEL
Download sequence
Identical sequences H3DMJ7
ENSTNIP00000021745 ENSTNIP00000021745 99883.ENSTNIP00000021745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]