SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021827 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021827
Domain Number 1 Region: 601-741
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-39
Family C-type lectin domain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021827
Domain Number - Region: 158-246
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00204
Family Myosin rod fragments 0.023
Further Details:      
 
Domain Number - Region: 212-322
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0222
Family MukF C-terminal domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021827   Gene: ENSTNIG00000018652   Transcript: ENSTNIT00000022063
Sequence length 748
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:20976260:20990577:1 gene:ENSTNIG00000018652 transcript:ENSTNIT00000022063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSDDFADEEEVQSFGYKRFGIQEGTECTKCKNDRALRVAIALLYVLCTLLTIAVAVLGYK
AVQRMDSVTEGMQNYGSIINAVETDLKKLDDQAGVKSVNATSVIMTFRSDLETLQHQLTD
ISLRVSRDKDFLHNIESSSENMRNSHVSVQSFLESSAASLRGVNQTLASYSSVINKLQTD
TAQLQSEIQDQVRVQSQIQVSVSALNVTQSQQRNVLSTLQKTVEDTSQVVQKLQNVYQEL
QQTARQNLADKEWLKEKVQNLQVLAANNSALVRFNGEALESLGFQLGKLVNKIQNTSALT
EGLEQSLRELMDHQRDHDNITSSKFDNMEVRLDRHEYDMDRLTGNLSFSAQVLGTITSDL
NSLKSCVETVMRHSDLLLGLNGSVTEIQADSIDLRTQQDELTARLDKEVNDLSMVMEEMK
LVDSKHSQLITNFTILQGPPGPRGPKGDRGLQGPVGQMGQRGEKGDNGLLGPAGAKGERG
PLGPPGLPGQKGTPGPPGFPGSKGSRGLAGRPGSPGEKGDPGLPGLPGKDGESGSPGPVG
PQGLRGPAGPVGLEGPQGLPGPIGLPGPPGLPGMPAPIPVPTSQVQTTAEPSGSVTQKVQ
TPAATTPAPRCPSRFRQFGDSCYYISSASQELNFEESYQFCNGMSSHLLIINNDEEQQFM
KKSIEENAFYWLGLTDKETENVWKWVDGSVPTYTYWRAGQPDNWKFGHEDGEDCAGLTHY
AYWNDFYCHQQIRFICERELDVCLKKIL
Download sequence
Identical sequences H3DMS9
ENSTNIP00000021827 99883.ENSTNIP00000021827 ENSTNIP00000001635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]