SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021833 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021833
Domain Number 1 Region: 516-675
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-44
Family MAM domain 0.00072
Further Details:      
 
Domain Number 2 Region: 167-335
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-25
Family MAM domain 0.0047
Further Details:      
 
Domain Number 3 Region: 345-506
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-24
Family MAM domain 0.004
Further Details:      
 
Domain Number 4 Region: 26-168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-17
Family MAM domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021833   Gene: ENSTNIG00000018658   Transcript: ENSTNIT00000022069
Sequence length 686
Comment pep:known_by_projection chromosome:TETRAODON8:4:9855831:9865243:-1 gene:ENSTNIG00000018658 transcript:ENSTNIT00000022069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSHFTMSIFFSLTEAIAQAQSQLLPGSCNFESSTCGYTSDGEFTSWNLHKDGIRVLCD
TTGYKAGRKQEITGTLVSPVLEYSEWSCLRLVYQIMGSGSLKVLQRTEGKSFDKPLWSGQ
TPSDSWVITSMDLKNNTESYKIIIEGKPGQSAGSSVAIFEIHIVPGYCLECDFEESHLCG
YSNQWNANVNWYVGGGRTQLLHNNIPNDHTFNNKTGHLMYVDSVYAKTFKEVAKLVSPMT
TVPLSGCLSFQYQRSDERGNIFSVFTRDHMGQYQELWRAGAQNESDWSGTLSEWIPVQVD
LKAPYSIQVVFEVAFNSPSGGRVAVDDISFSPQFCNKDNEPPFDPATASCNFEAGLCHYT
LDNVAGSSWRRVLVKRNIFQNGDHTTGTAGSFLLAHSQSRHSGYISRLIGQTLPGNMKYC
LRFFYSLSAGFNQTHSALMVYVQQQQSGTQEKIWTQGEKSRGIWIAADVTFQISQPAKLV
FISSCRDIWDCNSVALDDISLNLGDCNLATVSLASVLPGHCDFEAGLCDYSQDKQDDGAD
WEWRRGPTPTSYTGPRGDHSTGLGYYLYMEASATLPGQSIRLLSRPLRGFRGSQCLQFYY
HMYGSGTGELNLHLKYDSGEKLLWQQSGEQSISWLRATVEFQHDSQHQIVFEATRGASVR
SDIAIDDIVLEGGPCQGKYPLPSSHF
Download sequence
Identical sequences H3DMT5
ENSTNIP00000021833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]