SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021869 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021869
Domain Number 1 Region: 181-383
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.97e-30
Family Pentraxin (pentaxin) 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021869
Domain Number - Region: 78-167
Classification Level Classification E-value
Superfamily Tropomyosin 0.00275
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021869   Gene: ENSTNIG00000018691   Transcript: ENSTNIT00000022105
Sequence length 397
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:95984643:95987791:1 gene:ENSTNIG00000018691 transcript:ENSTNIT00000022105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THFYQIQFASIFICFLLVFTQWWQHSNIACVNEISSTHATSSPAPCGSPDLSKWDKMFSM
LENSQMRENMLLQYADDIIKLETRLRESLERLRLKEQNAAAARNSVGSSNHLEVTLQQLL
SSVQTQANRLAKLEGIHEQQVTSRQADLDGLPDALLQVKVALAEVLRSWQQRNLPAGCEM
ALLFPMRSRRIYAAVASEVPLALSAFTVCMWVKPTVVSGKTVLLSYGDRRNPFEIQLLLG
QTSALLTVGGEAHLVEARGVVKADGTSDWLHLCGTWSSDQGLASLWANGEKAVTTSGVAE
GHVLADGGSLQLGQERNDCCPPTQRKENRVPGFEGGFDPKLAFVGKMTGVNVWSRVLSAA
EISQLALREGRGCGQRGNVVAWGVTEMVPHGGAQFVH
Download sequence
Identical sequences H3DMX1
ENSTNIP00000021869 99883.ENSTNIP00000021869 ENSTNIP00000021869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]