SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021921 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021921
Domain Number 1 Region: 82-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.06e-28
Family Clostridium neurotoxins, the second last domain 0.013
Further Details:      
 
Domain Number 2 Region: 425-655
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000243
Family Reprolysin-like 0.063
Further Details:      
 
Domain Number 3 Region: 1282-1347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000133
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Domain Number 4 Region: 1343-1412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000167
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 5 Region: 1404-1471
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000848
Family Complement control module/SCR domain 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021921
Domain Number - Region: 873-932
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0231
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021921   Gene: ENSTNIG00000018742   Transcript: ENSTNIT00000022157
Sequence length 1626
Comment pep:known_by_projection chromosome:TETRAODON8:4:8120304:8174587:-1 gene:ENSTNIG00000018742 transcript:ENSTNIT00000022157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLWTPSCVFCLVILLLCFGSECGTVQRKGRSKRELVRIREAKATIPGACATRLPRGKRS
LPGLERRVLPQRRRSAQAVENSSDRGKSVYFTGRGDQLRLKPGVEIPRGNFTLEMWIKPE
GGQRSPTVIAGLYDKCFYASSDRGWLLGIEAVSEHGNRDPRFFFSLKTDRAHKATSIHSN
ARYVPNQWAHVAVTYDGVYMKLFVNGAQVGVSREQSGDVFSHLTKKCKVLMIGGNALNHN
YRGSVERVGLWRQARGQRQIIRDMQGHEDLQDLPQLVIRETFEHPGRKWLTVKDGSFPQA
EGAGSRIGNSEGLLDTTLEPPPCGQTVCDNIEVIKNYNNLWNFRRPKKVRYRVINIWDDE
QTRPTVTDHQISLQHQQLNDAFSPYNITWELSVYNVTSSPLRNRLILANCDISKIGDDVC
NPECNHPLTGYDAGDCMSGHRSRCPESKQGNGICDPECNWENFSYDLGDCCNPNITDVTR
TCFNRSSPYKAYLDVKELKEILQLDGSTHLNIFFANSSDEDLAGVATWPWDKEALTHLGG
IVLNPSFYGTFGHTDTMVHEIGHSLGLYHVFRGISEVESCNDACLETEPSMETGDLCADT
NPTPKYKGCHDPDPGNETCGCQDFTHTPFNNYMSYADDSCTDSFTLNQVARMHCYLDLIY
QTWQPASKPSPVAMPLQVVEQHHNSITLEWFQPISGHFYSREKSYASGGMLNCCSTHNSS
SPRPCDPYGHWSPREAEGPPDVEQACEPSVRTWSPNARIEQGVIGLSECPLQGCMLQLEF
PYPLVPDSLTVWVTFFSPEETALPAIHNILLLTVSGNNISLGPSNVFCDTPLTLKLDTEE
EVFGVQFFTMEQHLEIDATLLTSKPDCQLCRHCQPLHYRLLRHPPFTHAPHGLMLKEPIR
RYTDRDVVLRVAYTYQVQTISGRRESEPSPPLIHELGAPYCGDGRIQSSKGEECDDMNIL
NGDGCSSQCKKESFFNCIEEPSMCYYYDGDGVCEDFEQETGVRDCGLYTPNGFLDQWAAT
VEVSHEQKPYCSGEVAAGYPAVTKTYQSNVFDLSDGVSQYAWFPCREAHVTTWGYPNYWL
KAHFSHPMVAAAVIIHLATDGTAYVDQTQCNITVQLVDTKESIHSLGKHASECRNNPLVI
PVTHDLSVAFYHTKAILVTFVSRLVAISGVGLRSFQSFDPITISGCQSNEIYNPTGQRDR
ACCGFCCVPSFLTSLSLSSASSGCFSGWSRPGRCCSQFCRTDSFSSIFQQAHTCCAYSDS
TVTITCANGKWNKQISCEPVDCGLPDKYHVHPAHFTFPEGTTYGKKSTFQCREPAQLVGT
NNTLTCMEDGLWSFPEALCELRCPAPSPVPNAVLQTKRCNETGLKVGTLCKYKCRPGYHV
TNKPKRRAFKRQCTEDGSWLEGACEPVTCDPPPPIFHGSYHCTDGFRFDSICRLNCSDPA
AVDVHCFQGAVSNAIRCRKDGNWTGSFHLCPHIKGQCSLPQNLHYSLQYSCRRGHGIGEE
CELTCRENSNEVILPSNMTVEGVLKEHWRNPHKVKSIVCTMGLKWYPHPEFLHCIKGCEP
FMGDNYCDAINNRAFCNYDGGDCCQSTVKTKKVIPFPMSCDIRDECSCRDPNTIENRKDN
HVHSLR
Download sequence
Identical sequences H3DN23
99883.ENSTNIP00000021921 ENSTNIP00000021921 ENSTNIP00000021921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]