SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021932 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021932
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-27
Family Laminin G-like module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021932   Gene: ENSTNIG00000018753   Transcript: ENSTNIT00000022168
Sequence length 1629
Comment pep:known_by_projection chromosome:TETRAODON8:4:7240910:7281218:1 gene:ENSTNIG00000018753 transcript:ENSTNIT00000022168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDLLQKLGLKGEKPSRPLPAGIIPFRSGVILNQRAQIETQLRSLLPASIWANLSLVLSV
RSHRVNSAFLFTLLSERKKLLLGLQLTPNNLVLHTGPNTSVTLPYEPHDGQWHQLAVGIN
GHKVTLYASCGERSVNADFGWDSQEGLTPELQGTLLLGRTSQQQGSAHFEGAICQFDLVP
SAQAAHNYCRYIKKQCREADIYRPNLSPLLPIIPRDKNITITAATPKSGGLDAAKKPTRL
SLARSVAAAASAVRYVAPTQTIKPAPWTTPTPLLGTVMPVTVKFGLVSPPPKAKTETVTV
PLKIRVPPTKPPSSRPSTSKVLSQKTPKPTSTKPTQGNITKKTVGVTDKKKPALPATTST
KLTRTKTKSSLSEQGILPKKPQPATTKKTPPKPKTTPSKATPPKTKTDSAKTVSSKTTTS
SKVIPLQTTISKATTTKVSKTTSKQDIKPTKQAKTTKAPVTPRPTRRSYISVTPPATDGF
QSWEVPPTQFSLLAGPVGQKGDQGPSVSPLSCLPSELSAGRGKGFPGPPGKPGLPGKRGA
RGKKGDPGMSPGPAPKGEKQNDSFSFMQFNHAALHKRGSWREGGGEIYSCQNALILPQGA
PQLSRRRTRGKSTYRGEQGQKGYLGPPGLPGEPPYCTPKKGIPGEPGKRGKMGRPNEPEP
FGEKKNLHSGGLYGEMGAPGPKGVLGLIGDMGPLGEMGYYVPILIAPITSYLPHSSHSLF
KSKGEIGNPGEQGEIGFKGDKGILGLPGLPGVRGKPGPQGKIGEKGPDGSPGRPRVQGFP
GDMGSPGENGHEGPKGKPGLRGLPGPRGLPGLEGDEGPIGPPGLSGLEGRIGRKGFPGKV
GAEGLKGEPGVAGSIGSTGERGLVGFIGPVGEVGHSRREGDRGETGLPGPPGEKGPTGHP
GIPGETGPVGPPGRPGPPGATGPAGVRGPKGLRGAIGPDGPTGESGLEGKKASDGPPGKL
GFPGPQGKIGEPGEPGPKGFPGVQGPSGPLGDKGIAGVPGLPGPPGTVGLLGEVGQKGPP
GKAGEPGLPGEPGEKGDIGNAGNIGEQGLIGQRGEPGLEGEAGPAGPDGAKGDKGDTGQE
GDKGEKGETGLKGKEGPPGSPGLTGVRGPEGKPGKIGERGKLGSKGAKGHQGHLGETGSV
GKTGPPGFVGQKGSRGTIGHVGAPGRMGQQGEPGIAGYEGHQGPQGPIGRLGPKGEKGEQ
GDDGKVEGPPGPQGDIGPSGDRGERGEPGDPGYKGQVGEDGSKGMPVRQKLESYCSGRIF
FYWLCEYMHNVLMMCIQGEQGDDGETGSAKAGSRGKMGIPGLPGEQGSIGPKGDRGLRGQ
NGPPGKRGFKGGMGLPGPQGDAGTKGQPGDTGEQGFPGILGGFGPKGPPGDFGPKGIRGP
KGPQGTMGRGGVVGPVGIIGPGGSAGPRGEKGNRGETGFQGPRGSPGPRGPPGPPGRPAV
PASFQEDGLLFMDSHIPLRTEVGENKPVMDLPILDQGAEIFKTLHYLSNLIQSLKNPLGT
RDNPARICRDLHSCEQKLNDGTYWIDPNLGCSSDTIEVSCNFTGGGQTCLKPVTASKLVF
SAGRVQLNFLHLLSSEAVQHITIHCLNTSVWRSAEAPTATQGSVRFKAWSGEVFEVGGEL
EPEVIEDSC
Download sequence
Identical sequences H3DN34
ENSTNIP00000021932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]