SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021982 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021982
Domain Number 1 Region: 13-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.98e-70
Family FCH domain 0.0021
Further Details:      
 
Domain Number 2 Region: 371-427
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-19
Family SH3-domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021982   Gene: ENSTNIG00000018799   Transcript: ENSTNIT00000022218
Sequence length 428
Comment pep:known_by_projection chromosome:TETRAODON8:5:12334855:12339158:1 gene:ENSTNIG00000018799 transcript:ENSTNIT00000022218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNGDLSDLGSSDSFWEPGNYKRTVRRIDDGHRLCNELVSCFQERAKIEKSYALQLSDW
AKRWRGVVEKGPQYGTLEKAWHAFMMAADRLSELHLELRERLAGEDSEKIRSWQKEAFHK
QMMGGFRETKDADDGFRKAQKPWVRKLKEVEATKKSYHQTRKEEWTAVSRENHAKADPTK
SQEEVRKFTTRAERCNQEAEKAKERYTKALEDLNRCNPRYMEDMEQVFDLTQEAERKRLR
FFKDVLLDIHTHLDLSVKEEFAGLHRDLGRSIQAASDAEDLRWWRNTHGPGMSMNWPQFE
EWFPETSRSISRKERGERSEDNVVTLTNIVSAGGDRAPPSPNTNRGKDYSSDWSDDDSPK
KGLAVNGGAEGVRVRALYDYTGQEDDELTFKAGEELLKLGEEDEQGWCKGRLSSGRIGLY
PANYVQLV
Download sequence
Identical sequences H3DN83
99883.ENSTNIP00000021982 ENSTNIP00000021982 ENSTNIP00000021982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]