SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021993 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021993
Domain Number 1 Region: 387-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-47
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 1.86e-21
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021993
Domain Number - Region: 202-268
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0863
Family Tubulin chaperone cofactor A 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021993   Gene: ENSTNIG00000018810   Transcript: ENSTNIT00000022229
Sequence length 545
Comment pep:novel chromosome:TETRAODON8:18:10652048:10655688:1 gene:ENSTNIG00000018810 transcript:ENSTNIT00000022229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHASISVTESQFRCPVCLDVLKEPVSTPCGHTYCMSCLNNYWDQAEPGQVSCPQCREIF
SPRPVLRRNTVLAEVVDKLRLGGTVAAPSTSAEPANVPCDFCPAESQLRAARSCLVCLAS
FCELHVVPHREVGTLRRHKLVAAVQRLPERLCAQHRLGLQPAGGSEADAAGEWSGDCLLC
EADQEERRSVDAQRARRQLQLGETQRIIQERTRRGERELEEVQQSLESLKVSASAVLEDS
EAVFADISARLEKTRAEVRARLEAKERAVVGQTERHMETLEKDLEELRRRDQEISQVLQS
GDSAHFSQSTQAAPLLCVPLAAGWHNRGAGWPSEAFGAARRALSRLRSRMEEVCREEVDH
ISRAVNENYISAGECVKDLFFLLGVCRLSLDPDTAHPTLVLLEGGQVHCGEEPQSYPPHQ
QRFDSVAQVLCREGQFGDASYWEVEWRGGGWADIGVTYRGIGRKGGGKPCLLGRNENSWR
LRCTHAGYAAWHDNRKTTVAAPVCPRIGVFLERHKGTLSFYSISDTVVLLHTFRCPFSQP
LYPAF
Download sequence
Identical sequences H3DN94
ENSTNIP00000021993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]