SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021998 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021998
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-37
Family Galectin (animal S-lectin) 0.0000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021998   Gene: ENSTNIG00000018815   Transcript: ENSTNIT00000022234
Sequence length 133
Comment pep:known_by_projection chromosome:TETRAODON8:18:10530579:10531473:-1 gene:ENSTNIG00000018815 transcript:ENSTNIT00000022234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPQKIKNFSFKEGSELKVRVKPKDGCSCFSINIGHDPDNLALHFNPRFDYGGDHNTIVFN
TLSGGCWGDEHREGNFPFAQGDEAKCYINFNMEQFYIKLPDGHMLNYPNRLGDVKYDYFD
IGGDAELIGFKIK
Download sequence
Identical sequences H3DN99
99883.ENSTNIP00000021998 ENSTNIP00000021998 ENSTNIP00000021998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]