SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022012 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000022012
Domain Number - Region: 182-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0154
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022012   Gene: ENSTNIG00000018828   Transcript: ENSTNIT00000022248
Sequence length 515
Comment pep:known_by_projection chromosome:TETRAODON8:18:10307695:10309855:-1 gene:ENSTNIG00000018828 transcript:ENSTNIT00000022248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKMRRHRVFLLCTVGLCVISFLHYYKALHYVSLLRELSAPYPNIKSFIMVTGFFWREKGA
ATTPLSPSSPDEAPPFPGIRQLDAKDPIEMMGDLHTRLYHLQDDRTAYFVRTKAGALCFR
QGTEAAAPREYSARAAGSVAHGDGEGPPGMAAGQRKPLQVQQQPSLSPKAKSRSRGSGKR
LVKCVCRPGWHGPYCGVPTMVYHSNLPTKERLIPRETPRRVINAININHEFDLLHARLHE
LADAVDLFLICESNFTAYGDRRPLTFLQLLLNGTYDYVRHKILYVFLDHFPEGGRQDGWI
ADDYLRTFLTQNGLSRVVGARPDDVFVINDADEIPAREGLLFLKLFDGWTEPFAIHMRKS
LYGFFWKQFGTLEVVSGCTVGMLQKVYDGDGIKLRRREYYSMPGFRKYENETGHILVQWS
VGSPVHFAGWHCSWCFKPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRDLIRTGGWFDG
SQQEYPPVDPKEHMYAPKYILENFGKYHYLLENPY
Download sequence
Identical sequences H3DNB3
ENSTNIP00000022012 ENSTNIP00000022012 99883.ENSTNIP00000022012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]