SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022014 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022014
Domain Number 1 Region: 497-757
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.81e-93
Family Eukaryotic proteases 0.0000483
Further Details:      
 
Domain Number 2 Region: 36-166
Classification Level Classification E-value
Superfamily SEA domain 1.01e-17
Family SEA domain 0.0039
Further Details:      
 
Domain Number 3 Region: 291-396
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-16
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 4 Region: 165-280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000746
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number 5 Region: 403-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 6 Region: 437-469
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022014   Gene: ENSTNIG00000018830   Transcript: ENSTNIT00000022250
Sequence length 759
Comment pep:known_by_projection chromosome:TETRAODON8:18:10283680:10290341:1 gene:ENSTNIG00000018830 transcript:ENSTNIT00000022250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKTRSCKCLLVLFVVILIILIITGAALAWYFLDYRVWVLEPRVQQQYVVYLSILNRNFSA
DLSSHTSPTFKREARGVQSTVEKVMRSSSLSRYFNYTTVFAFGEGSVVAHLWLVMSVPSS
HVGAITVEKLSKSLQKGLERYSGSNNQMASLPGYIFHLASLSVTDCYRYQRVLSSSPVAL
RGPDTQRSTCMWHLQAAPGTQLELQMEWLLPECRDRLLVYNSLTPTDTHLITSVYGCSRH
EPVVRVLSSGEWMTVLWKQGLYNYKDPFSLSAQAWEHQDCNSTVELRAVLGVQGSLKTPF
YPSYYPPDTNCTWTFNMPAVGMGLSLEFEGYELSRAGYQQDCTQGQWIIQNRRLCGTRGL
QPYTERLFLPSSTATVVMTSEVSLTGPGLQLHYKVFNLSDPCPGQFLCTTNGLCVSACDG
IKDCPTGLDERNCVCVAQFQCLEDSQCVDYYKVCDQHPDCSEASDEDPCQESVACTDMTY
MCADGTCLKKPNPECDFVTDCPDASDEKQCDCGLRQFSSRIVGGTNATEGEWPWQASLQV
RGNHICGGALISSQWVVSAAHCFYDDRLYSPSMWTVYLGKLLLNRGSPTEEVARVQQIHL
HPYYDDDSHDYDLALLKLERPAGAVLAGHARPACLPPPTHQLEPDLLCWVTGWGSLQEGG
RASNVLQKVDVRLVSEDACIRSYGHLVTPRMLCAGYRSGEKDACQGDSGGPLVCQEPSGR
WFLAGVVSWGRGCGRPDYYGVYTRITRLTGWIKEVIGSP
Download sequence
Identical sequences H3DNB5
ENSTNIP00000022014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]