SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022040 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022040
Domain Number 1 Region: 497-657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-42
Family MAM domain 0.00061
Further Details:      
 
Domain Number 2 Region: 331-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-27
Family MAM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 161-320
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-25
Family MAM domain 0.0017
Further Details:      
 
Domain Number 4 Region: 23-161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-18
Family MAM domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022040   Gene: ENSTNIG00000018855   Transcript: ENSTNIT00000022276
Sequence length 677
Comment pep:known_by_projection chromosome:TETRAODON8:12:11996638:12003169:1 gene:ENSTNIG00000018855 transcript:ENSTNIT00000022276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLRGQKIKLEVLVLVGAVGGLAPGSCSFERDTCGYSPAPELGGWSRNHKGRSILVDSAS
LRGQEQAVLVSPVLERPGWSCVRLVYQISGRGSLQLHLRPQGDNFDYRLWWTREASDSWL
IASVDLPNGTAPFQLLLEGGPGPGSSSRVEVFEILVVPGYCLECDFEEEHRCGYSNSWNP
NVNWYVGGSAAAGNQTDGQQRATLSPAPGQYMFVDSEHVRHFQEVAQLSSPMTTAPMAGC
LSFYYRDQQRGNVFSLFTRDQLGHYEEIWRPQVDATPGWTLVGVDIRAPHPLEVVFEVAF
NRAKGGYVAVDDISFSPEFCHSDTEPTVDPSVADCDFDTGLCLYHQERAESKGWSRVTVS
PNAYRMGDHTTGTGWFLQANVRSASTPGYVGRLHGPLLPGNQRYCVRFYYLLQASRKVDN
ALILYVYDEHDVAVEKVWSLSGSSGAVWTRVEVTFLKPMLTKLVFASICRNFWECGLVAI
DDITVRLGDCRIAAGSLPGQCDFDDGLCGYRQDTVEDKGDWLPARGHTPTSYTGPRGDHT
TGVGSFLYIEASKMRPGHKARLLTSDLRGSSSPQCLVFHFHMYGSGSGILSVLLRQGGGQ
PDSLLWRRRGEQGIGWMRATVDYRCGVRHQIVFEAIRGPSLRSDIAIDDVAFQPGPCEGP
PDGAPFSGFDEYFNQIE
Download sequence
Identical sequences H3DNE1
ENSTNIP00000022040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]