SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022062 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022062
Domain Number 1 Region: 317-497
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.44e-37
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.022
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily Macro domain-like 3.36e-16
Family Macro domain 0.0028
Further Details:      
 
Domain Number 3 Region: 214-279
Classification Level Classification E-value
Superfamily WWE domain 0.00000334
Family WWE domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022062   Gene: ENSTNIG00000018877   Transcript: ENSTNIT00000022298
Sequence length 498
Comment pep:known_by_projection chromosome:TETRAODON8:12:12294160:12296551:1 gene:ENSTNIG00000018877 transcript:ENSTNIT00000022298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKSTVYAALKLCEEKTFRSAAFPALGTGVGGVPPAAVADAMVGAVADFAKKQPKSIHLAK
IVIFQPEMLTHFHNSMMKMQGEAARSKGFMSTIKDAVTSLFGYGEEKEPRKTLVLQKEEF
EPAVFQLCGQNKKDVDLAKQRIVALIQKEQVTRIIKDELVCHLTQADMADLESLQQQLTI
SIQLKEGLDEEEPSICLEGLTRDVFLAEPAIRSLLLRVQQRRTQKHKAVQMSECVEWQYQ
DPSGQMVAFDAQSNLLLEEALVAHEPVKLKINGETYQANPAFKMAFSSKREEVELLRVDK
KAVLPPYWTDMGESLFQLVCLDSSSGDYKDVEQKMTSRGLRLNILKIERVQNVTLWQTYQ
VLKGSMEKKNGHTNNEKQLFHGTKAAVTDFINKYGFNRGYAGMHGAMYGNGTYFAVDPAY
SVRRYAKPDALGHQRMYLARVLVGDFTKGQQSIAAPPARDQARPSDLYDSVTDNEATPSM
FVIFHDAQAYPEFLITFT
Download sequence
Identical sequences H3DNG3
99883.ENSTNIP00000022062 ENSTNIP00000022062 ENSTNIP00000022062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]