SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022085 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022085
Domain Number 1 Region: 664-763
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.61e-22
Family Tudor domain 0.0035
Further Details:      
 
Domain Number 2 Region: 114-208
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.78e-20
Family Tudor domain 0.0021
Further Details:      
 
Domain Number 3 Region: 3-32
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000164
Family MYND zinc finger 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022085
Domain Number - Region: 376-443
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00589
Family Staphylococcal nuclease 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022085   Gene: ENSTNIG00000018898   Transcript: ENSTNIT00000022321
Sequence length 763
Comment pep:known_by_projection chromosome:TETRAODON8:2:8649202:8655203:-1 gene:ENSTNIG00000018898 transcript:ENSTNIT00000022321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKFRCKRCKNASYCCAECEEKDWMAHRHICKPADPEPALVIKPMNPSDLFTNKACHSNDC
PGLLKPCDPSKQQRIFMKDLPVTAVKETDIQAKVVEFYNPGRFFLLAPKPEVMEALQVIA
TKLQNTYSFKPATLYMPCVGEVCAVQYSFDMNWYRGLVQAMTADKKMAHVLYIDFGNEEY
VPLGRIRQLATNIQSFCPCVMECSVAQVVPVGGSWSAECCIAVRQLLEDRIFTVHLVETL
ENGRIHAVDIKLSMGKLSTFLIEHGYATANNVNIMPTEQEICELMNASLENFKRLSDGKD
DNSWAQPPEPLTQVVGDSFSVVVTHLQSPSDFTVQKVENARVIQELQLKLKEHCCQVTTP
QSFRPAPGTVCCAQFSRVQPVGENWSEECILALQQRLYNRILRMEIQGAREGRALVVMID
ETSDPQDNVAELLISAGFASPVAVSTSMFLRVSVPSASSEALAWCCAELPFDGQTVSLLA
SVVKNPQEFYCHINNQKDLQQLIELGAELKKHCAGNSSSCVPKVGEPCCAMNVGVAPLGS
AWSSEAKQWFRSQMDGELLTARVLSVSERGYEVKLEIRGRDVAAALISEQLAKAPGAILK
MSRVRAESKLLENIDLVSGPSFPVDWKATELPVSGTFRPCIPAFISPSLFYVLCPVQGQK
MDQQKLRGMMTELAAYCSNNISVSSRSSSSVLSRAAPGAVCCAQFSADNIWYRAVVLEVG
ENELKVLYADYGNTEMVPFSRILPIPKHLLQIPFRITRCTLTG
Download sequence
Identical sequences H3DNI6
99883.ENSTNIP00000022085 ENSTNIP00000022085 ENSTNIP00000022085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]