SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022089 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022089
Domain Number 1 Region: 257-561
Classification Level Classification E-value
Superfamily Kelch motif 1.09e-49
Family Kelch motif 0.0069
Further Details:      
 
Domain Number 2 Region: 658-833
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-24
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 3 Region: 34-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-20
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 4 Region: 980-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000213
Family Laminin-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022089   Gene: ENSTNIG00000018902   Transcript: ENSTNIT00000022325
Sequence length 1348
Comment pep:known_by_projection chromosome:TETRAODON8:2:8576546:8609048:-1 gene:ENSTNIG00000018902 transcript:ENSTNIT00000022325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRASPAKPCDKPCLSGKCINGSCVCERGWVGDQCQHCQGRFKLTEPSGYLTDGPVNYKYK
TKCTWLIESYPNAVLRLRFNHFATECSWDHMYIYDGDSIYAPLVAVFSGLIVPETRGNET
VPEVETTSYALLHFFSDAAYNLTGFEIFYSINSCPNNCSGHGKCTPGNSAASRVYCECDK
YWKGEACDIPYCRNNCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLTVPSTESFWILPSVK
PFGTSLARASHKAVVQEKVMWVVGGYTFNYSAFQMVLNYNLESGVWNTVPINSGLMPRYG
HSLAAYQDEMFMFGGQVEGGGGNVSDELWVFNVPSRTWQRRNPVVAQPAHTQMFAVEGHS
AHCIQLEGGDAVMLVIFGYSPIYSYINTIQQYNLKSNTWSVLETEGAVPQGGYGHTSTYD
AGSGSVFIHGGYRALLANKFGLVDDLYRYDVNSRTWFILKESGFPRYLHSAVLLSGTLLI
FGGNTHNDTSLSNGAKCFSADFLAYDIACDEWRLLPKPDLHRDVNRFGHSAVVSNGSMYV
FGGFSGMLLNDVLVYRPPSCQAFGTEESCVQAGPGVRCIWSRSRCFSSEPSIANETLTLQ
SFSPTKPLHEPSYPFSDCPSCTPNTNRSQSSHNNKSISPSSNCTSVTFSVKNFTECPVRN
EQVCTKFANCKSCLLNLNCQWDLNQSECHALPAQQCSEGWSQVGEACLRINSSRESYDNA
QHYCKNLNGNIASLTTPKQVDFVLEELKKLQQQDKASSLSSQRLSPWVGLRKINVSYWGW
EDMTPFTNSSLRWLPGEPSDSGFCAYLEEPQVSGLRANPCTATAHGLICEKATGNPSPSP
RATCRKPCTLHIGCNNCTHQALECMWCTSTQRCVDSSAYVISFPYGQCLEWQTGDCFSQN
CSGLRTCSQCLEHPMCGWCGDPSSTGRGVCMEGSYRGPMKRPARQGQSVQANLPQDASLE
LGNCPREKGFEWAFMQCPACQCNGHRTCVNSSVCEQCRNLTTGPNCQSCMRGYFGDPTNG
GKCQACKCNGHANVCNVVNGKCYCTTKGIKGEQCQLCDSENRYLGNPLRGTCYYNLLIDY
QFTFSLIQEDDNYYTAINFMASPEQNARMTIMSQVLSLCTLSLEISNTFTAGTISGEEVP
IVSKTNIKEYRDSFSCEKFTFRSNPNITFYVYVSNFSWPIKIQIAFSQHNSIMDLVQFFV
TFFSCFLSLLLVAAVVWKIKQTCWASRRREEEDRKMLREIEEAAAECMDLMQPMVDVERQ
EPDTIGAIKGAPKPVAMEPCSGGKAAVLTVLLRLPSGPSGLPPPGQSGLIVASALVDVSQ
QKPSDFKDKSQSLKSRKALPPAHQGTCV
Download sequence
Identical sequences H3DNJ0
ENSTNIP00000022089 ENSTNIP00000022089 99883.ENSTNIP00000022089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]