SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022099 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022099
Domain Number 1 Region: 795-905
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.00089
Further Details:      
 
Domain Number 2 Region: 478-594
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0044
Further Details:      
 
Domain Number 3 Region: 707-795
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-19
Family Cadherin 0.0059
Further Details:      
 
Domain Number 4 Region: 119-236
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-19
Family Cadherin 0.0033
Further Details:      
 
Domain Number 5 Region: 907-1014
Classification Level Classification E-value
Superfamily Cadherin-like 2e-18
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 1119-1243
Classification Level Classification E-value
Superfamily Cadherin-like 4e-16
Family Cadherin 0.0025
Further Details:      
 
Domain Number 7 Region: 594-683
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-16
Family Cadherin 0.002
Further Details:      
 
Domain Number 8 Region: 1019-1123
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000157
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 370-482
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000353
Family Cadherin 0.0074
Further Details:      
 
Domain Number 10 Region: 284-368
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000128
Family Cadherin 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022099
Domain Number - Region: 51-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.0722
Family Cadherin 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022099   Gene: ENSTNIG00000018912   Transcript: ENSTNIT00000022335
Sequence length 1718
Comment pep:known_by_projection chromosome:TETRAODON8:2:8219386:8278329:1 gene:ENSTNIG00000018912 transcript:ENSTNIT00000022335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSFSSPFPECKLSRSGPPATIVAIDEESPNGTLLVENMQINGVAEGPDRTISLSLRDNYD
HWVILEPSKQALYLNSTGRVLDRDPPSYIQSIVVQVQCTNELVGTVILHEVRIVVRDRND
NAPRFTQPRYYVAVSELTPVGTTIFSGFFGNNGATDIDDGPNGQIEYTIQYNPNDPDRTN
RTFDIPLTLFGAVVLRERLNYEEITRYLVIIQANDRAPYPSERRTATTTLTVDVLDGDDL
GPMFLPCTLVGNTRDCSPITYRANVLEMTEPIHNKVNPLNVTPPIQAVDQDRNIQPPSDR
PGILYSFLIGRPESYTEYFSLNKTTAELLLLKPIYRELHSRFDLVIKAEQDNGHPLPAFA
NLQIEVLDENNQAPYFLETSYHGYVNEATPVGTTVSTNASLSAPLVIVALDNDVEETRDP
QLQLTLDMYSDVFSVSASGIRRYLTVAQPLDREAQDSYTFTLLASDGVQQSIPVPVTITV
LDANDNTPTFANVSYSVNLFTDITPGETVIELLAVDFDAGPNGQVNYRILAGDQGHFLIS
TSTGVITVAPGVDLTVGRSYALTVEAADNGAIPHRRSSITTVYIEVLPPNNQSPPRFPRQ
QYNLEVSEAMRTGATLLQLQAVDREKDPIAYEIRSGDLHGRFALQQNSGYLLLSTPLDRE
SLDHYTLEVTASDGHPDGVRTEVSALVCTQICSKCPVFKFLNSLPVNLTVTEERGHAYVG
QVKATDPDLGASGQVHYRLVNHQTLFSINASGAIQTEGPLDREVKGHYFLIVEASDGATD
PRRSRLTLSVTVLDVDDNSPMFSQQSYSASLAENSPKNTTILQLKAIDADLNSNLTYRIR
SEGVDPEILQLFYLNPGTGELSVLKVLDYEAFNESDPKYTFTVEATDAGGTMPPGLASVT
VRIMDMNDFSPVFGQSLYRGMVAPNAVKGTIVTTVMANDSDAVGTPAGLVRYKVDPEAYP
YSASIFDVDEKTGNVVTRVNLNEEPSLKFNLLVVAYDDGEPPKENTALVEITVLQPSVIP
VFTQEEYRFPPVSEEAEVGTPVGTIMAAAVNQTIIYSIVEGNEGGEFTLNETTGVVSTAR
GLDYESSSSFVLKVEADSIAVASSNLRVPSKTNTAKVIIDIRDENDHQPVFTRSLYIGGV
TEDAKTFTSVLQVQALDQDTGNYSSMVYRLIIPPPAGKETKDNKDGFVIEPYSGVVKTAI
MYRNMRRSYFKFEVVATDNYGQGHSSKAEIVVSVVNQLDMQVVVSNVPPTYVEKYKNKLL
GILERYVQEQIPEAKVVVETIGPHRHGDGLEQDDYTKSDLMIYAIDPLTNRAVSRQELHK
FLDGKLLDINKEFQPFFPPGGRILEIRTPEVVTSVKKAVQTVGYTEGALLALAVIIIICC
VPAILIVIITYRQRQAECAKSAQIQMALPAGKPAGGTTNNLYEELGDNSIRGYGQQETQQ
LLRPSLLRPEELSMESGIDPGQDYYTQDYYSCDHGYDLPHYGSRRKLISPSGLYDEYGDV
VVDDDGCYYYSPQESDGEFGSRKRRLKLVLDRECESSSTGEDSVVENQRSRLPPSLNSHA
NINGSIYVAQNGSIIRTRRSVTTPGPLHTHTNANNNLKIPSPVFSSRLAKHFKKLDKLAA
TLEERVPLHGPTGEAGCKTLHTFQGSGTAGPVTAADRNKTLTGTSTQQSNMSDGSTTDDD
QGLVLRGPLGCPSGRTQSDEEELWMGPWNNLHIPMTKL
Download sequence
Identical sequences H3DNK0
ENSTNIP00000022100 99883.ENSTNIP00000022099 ENSTNIP00000022099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]