SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022100 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022100
Domain Number 1 Region: 788-898
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-24
Family Cadherin 0.00089
Further Details:      
 
Domain Number 2 Region: 473-589
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-21
Family Cadherin 0.0044
Further Details:      
 
Domain Number 3 Region: 697-795
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-19
Family Cadherin 0.0041
Further Details:      
 
Domain Number 4 Region: 116-233
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-19
Family Cadherin 0.0033
Further Details:      
 
Domain Number 5 Region: 900-1007
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 1112-1236
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-16
Family Cadherin 0.0025
Further Details:      
 
Domain Number 7 Region: 589-678
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-16
Family Cadherin 0.002
Further Details:      
 
Domain Number 8 Region: 1012-1116
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000127
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 365-477
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000275
Family Cadherin 0.0074
Further Details:      
 
Domain Number 10 Region: 278-363
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000485
Family Cadherin 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022100
Domain Number - Region: 48-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.0628
Family Cadherin 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022100   Gene: ENSTNIG00000018912   Transcript: ENSTNIT00000022336
Sequence length 1410
Comment pep:known_by_projection chromosome:TETRAODON8:2:8218989:8266739:1 gene:ENSTNIG00000018912 transcript:ENSTNIT00000022336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWQYEECKLSRSGPPATIVAIDEESPNGTLLVENMQINGVAEGPDRTISLSLRDNYDHWV
ILEPSKQALYLNSTGRVLDRDPPSYIQSIVVQVQCTNELVGTVILHEVRIVVRDRNDNAP
RFTQPRYYVAVSELTPVGTTIFSGFFGNNGATDIDDGPNGQIEYTIQYNPNDPDRTNRTF
DIPLTLFGAVVLRERLNYEEITRYLVIIQANDRAPYPSERRTATTTLTVDVLDGDDLGPM
FLPCTLVGNTRDCSPITYRANVLEMTEPNKVNPLNVTPPIQAVDQDRNIQPPSDRPGILY
SFLIGRPESYTEYFSLNKTTAELLLLKPIYRELHSRFDLVIKAEQDNGHPLPAFANLQIE
VLDENNQAPYFLETSYHGYVNEATPVGTTVSTNASLSAPLVIVALDNDVEETRDPQLQLT
LDMYSDVFSVSASGIRRYLTVAQPLDREAQDSYTFTLLASDGVQQSIPVPVTITVLDAND
NTPTFANVSYSVNLFTDITPGETVIELLAVDFDAGPNGQVNYRILAGDQGHFLISTSTGV
ITVAPGVDLTVGRSYALTVEAADNGAIPHRRSSITTVYIEVLPPNNQSPPRFPRQQYNLE
VSEAMRTGATLLQLQAVDREKDPIAYEIRSGDLHGRFALQQNSGYLLLSTPLDRESLDHY
TLEVTASDGHPDGVRTEVSALVCTQISNEMKLFIPSLPVNLTVTEERGHAYVGQVKATDP
DLGASGQVHYRLVNHQTLFSINASGAIQTEGPLDREVKGHYFLIVEASDGATDPRRSRLT
LSVTVLDVDDNSPMFSQQSYSASLAENSPKNTTILQLKAIDADLNSNLTYRIRSEGVDPE
ILQLFYLNPGTGELSVLKVLDYEAFNESDPKYTFTVEATDAGGTMPPGLASVTVRIMDMN
DFSPVFGQSLYRGMVAPNAVKGTIVTTVMANDSDAVGTPAGLVRYKVDPEAYPYSASIFD
VDEKTGNVVTRVNLNEEPSLKFNLLVVAYDDGEPPKENTALVEITVLQPSVIPVFTQEEY
RFPPVSEEAEVGTPVGTIMAAAVNQTIIYSIVEGNEGGEFTLNETTGVVSTARGLDYESS
SSFVLKVEADSIAVASSNLRVPSKTNTAKVIIDIRDENDHQPVFTRSLYIGGVTEDAKTF
TSVLQVQALDQDTGNYSSMVYRLIIPPPAGKETKDNKDGFVIEPYSGVVKTAIMYRNMRR
SYFKFEVVATDNYGQGHSSKAEIVVSVVNQLDMQVVVSNVPPTYVEKYKNKLLGILERYV
QEQIPEAKVVVETIGPHRHGDGLEQDDYTKSDLMIYAIDPLTNRAVSRQELHKFLDGKLL
DINKEFQPFFPPGGRILEIRTPEVVTSVKKAVQTVGYTEGALLALAVIIIICCVPAILIV
IITYRQFKERQAECAKSAQIQMALPAGKPA
Download sequence
Identical sequences H3DNK1
ENSTNIP00000022100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]